KEGG   Dictyoglomus thermophilum: DICTH_0724Help
Entry
DICTH_0724        CDS       T00774                                 

Definition
(GenBank) SigF
  KO
K03090  RNA polymerase sigma-B factor
Organism
dth  Dictyoglomus thermophilum
Brite
KEGG Orthology (KO) [BR:dth00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dth03021]
    DICTH_0724
Transcription machinery [BR:dth03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     DICTH_0724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r2 Sigma70_r4_2 Sigma70_r3 HTH_37 HTH_23 Sigma70_ECF HTH_24 HTH_28 HTH_Crp_2 MarR_2 HTH_3 HTH_10 HTH_38 GerE HTH_Tnp_ISL3 DUF2316 HTH_26 HTH_5 HTH_17 HTH_6 DUF1319 HTH_31 TrmB MarR DUF134 TnsD HTH_Tnp_4 Minor_tail_Z LexA_DNA_bind DUF1492 NYD-SP28
Motif
Other DBs
NCBI-ProteinID: ACI18924
UniProt: B5YDI5
Position
733750..734457
Genome map
AA seq 235 aa AA seqDB search
MIKPALELWLKYRETGDKKVLEELLEVFDDLIYYWASKFTSYGEPLEDLVQIGYLGFLKA
VENYDPEKGDLSTYISHYVLGEIRHHLRDKIDKIKIPRSVKGLINKMDNFIKEVWEKENR
SPSCEEIAKHLNITVESVEELFKIKEAMMTVSLEDLEIEMDRIRAEKLESFKLPIEDKIA
LEQALAKLPDIQRKVIEYIFYQDLTQTEVAKILKISQSQVSRILRSALEKLKEML
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgataaaacccgctttagagctttggctaaagtatagagaaacaggggataaaaaagtt
cttgaggaactccttgaagtttttgatgatctgatatactactgggcttcaaagtttact
tcttatggagagcctttagaagacttagtacaaataggttatcttggctttttaaaggct
gttgaaaactatgatcctgaaaagggtgatctttccacatacatttctcattacgtatta
ggtgaaataaggcatcatttaagggataaaatagataaaataaaaattccaagaagtgtt
aagggtttgataaataagatggataattttataaaagaggtgtgggaaaaggaaaataga
tctccttcttgtgaggaaattgcgaagcatctaaatattactgtagaatcggtagaagag
ctttttaaaattaaagaggctatgatgactgtatctctggaagatttagagattgagatg
gatagaataagagctgagaaattagaatcttttaaacttccaatagaagataagattgcc
ttagaacaagcattagctaaacttcctgatatacaaagaaaggtaattgagtatattttt
tatcaggacttaactcaaacagaggtagcaaaaatattaaagatatcccagtcacaggtt
tcgagaatattaaggagtgctttggagaagttgaaagaaatgctttaa

DBGET integrated database retrieval system