KEGG   Dictyoglomus thermophilum: DICTH_0727Help
Entry
DICTH_0727        CDS       T00774                                 

Definition
(GenBank) Smc1 chromosome segregation protein, putative
Organism
dth  Dictyoglomus thermophilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PhoU_div Syntaxin_2 CC2-LZ BLOC1S3 Bacillus_HBL YpjP NAAA-beta Dna2 Seryl_tRNA_N
Motif
Other DBs
NCBI-ProteinID: ACI19160
UniProt: B5YDI8
Position
735541..735963
Genome map
AA seq 140 aa AA seqDB search
MAEDRWKKLWDTLKPQIASAIQKAGETAQKAGEVISEMAKTLGKESAKLAKIGKLKADIL
ILEGNKDNLLRKLGEKLYQLYKNEEEIKKEVFSELVKEIEELDKKILEKQKEIESIAKEE
NLNPEDIEKIPAVEDEEKKD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggacagatggaagaaactatgggatactctaaagcctcagatagcttcggca
attcaaaaggcgggagagactgctcaaaaagctggtgaagtaatttcagagatggcaaag
actcttggtaaagagtctgctaaactcgctaaaattggaaaattaaaggcagatattctt
attcttgaaggaaataaagataaccttttaagaaagcttggagaaaagttataccaatta
tataagaatgaggaagagattaagaaagaagtattttctgagcttgtgaaagaaatcgag
gaattagataagaagattttagagaaacagaaagagatagaaagcatagcaaaagaggag
aatttgaatccagaagatatcgaaaaaattcctgctgttgaagatgaagaaaagaaagat
taa

DBGET integrated database retrieval system