KEGG   Dictyoglomus thermophilum: DICTH_0730Help
Entry
DICTH_0730        CDS       T00774                                 

Gene name
coaE
Definition
(GenBank) dephospho-CoA kinase
  KO
K00859  dephospho-CoA kinase [EC:2.7.1.24]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00770  Pantothenate and CoA biosynthesis
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DICTH_0730 (coaE)
Enzymes [BR:dth01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.24  dephospho-CoA kinase
     DICTH_0730 (coaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoaE AAA_18 AAA_17 AAA_28 DUF2240 PGM_PMM_II AAA_33 Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: ACI19583
UniProt: B5YDJ1
Position
739205..739813
Genome map
AA seq 202 aa AA seqDB search
MSYKIGITGGIGTGKSLVSNILKELGIIVISADEIVRELQKDPYYLQKIREIFGDNVFDK
GNLDRKKLAKIIFSDSDARRKLENLLHPPVLEEIKKKLEELKERDIIAVEVPLLFEVGIE
DWFDEIWVVYAPFELQLERIVNRDNISKEDAVARIRAQIPIEEKLKKADFVIYNDKDIES
TKNQIKERVSTIYRMIYNKNLE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgagctataagattggtataacaggtggtattggcacaggaaagtctcttgtaagtaat
attctgaaggaacttggaataattgtcataagtgctgatgagattgtaagagagcttcag
aaagatccttattatctgcagaaaattagagaaatttttggggataatgtttttgataaa
ggtaacctcgataggaagaaacttgcaaagataattttttcagattctgatgcaagaaga
aaattagagaatcttcttcacccgcctgtcctagaagaaattaaaaagaaattagaagag
cttaaggaaagagatataattgctgtggaggttcctcttttgtttgaagtggggattgaa
gattggtttgatgaaatctgggttgtttacgctccatttgagcttcaacttgaaagaatt
gttaatagagataatatatcaaaagaagatgctgttgcaagaataagagctcaaatccct
atagaagaaaagcttaaaaaagctgattttgtaatctacaatgataaagatatagagagt
actaaaaatcaaattaaagaaagagtttcaaccatatacagaatgatatataataaaaat
ttggagtaa

DBGET integrated database retrieval system