KEGG   Dictyoglomus thermophilum: DICTH_1154Help
Entry
DICTH_1154        CDS       T00774                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00260  Glycine, serine and threonine metabolism
dth00400  Phenylalanine, tyrosine and tryptophan biosynthesis
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01130  Biosynthesis of antibiotics
dth01230  Biosynthesis of amino acids
Module
dth_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_1154
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DICTH_1154
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     DICTH_1154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACI19101
UniProt: B5YEN1
Position
complement(1115045..1116400)
Genome map
AA seq 451 aa AA seqDB search
MMSQVKFLLDESKIPKDWYNIIPDLPFPLPPVYHPVTLQPVSPEDLAPIFPMELIKQEVS
TERYIEIPEEVRKIYKLWRPTPLFRAVNLEKYLDTPAHIYYKYEGVSPPGSHKPNTAVAQ
AFYNKLEGVKRLTTETGAGQWGSALAMACNFFKLECKVYMVKVSYYQKPYRRSLMEIWGA
KVVPSPSPDTEAGKKILEQDPESPGSLGVAISEAVEDAVKRDDTKYSLGSVLNHVLLHQT
VIGEEALLQMEMAGEFPDVVIGCVGGGSNFAGLSFPFIREKFKGKKIRVVAVEPESCPSL
TKGVYTYDYGDVAKMTPLLKMYTLGHNFIPPAIHAGGLRYHGMAPLVSALYHNGYIEAVA
YPQTKVFEAGVIFARTEGIVPAPESTHAIRAAIDEALDAKEKGEKRVILFNLSGHGFFDL
SAYDQYLSGKLEDYFYPKDKVEEALKELPKI
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcgcaggttaagtttctccttgatgaatccaagataccaaaggactggtacaat
attattcctgatctaccttttccgcttcccccggtttatcaccctgttactttgcaacct
gtaagtcctgaagatcttgctcctattttccctatggaactcataaaacaagaggtaagt
acagagagatatattgaaattccagaagaagtgagaaagatatataagctgtggagacca
acacctttatttagagctgtcaatcttgagaagtatctggataccccagctcatatatat
tataaatatgaaggagtaagtcctccaggaagtcataagccaaatactgctgtagctcaa
gccttttacaataaacttgagggggtaaaaagattaactacagaaacgggagcggggcag
tggggttcagctcttgctatggcttgtaatttctttaagctggaatgtaaagtttatatg
gttaaggtgagttattatcaaaaaccatacagaaggtctttaatggagatttggggagct
aaggtagtaccaagcccaagtcccgatactgaagctggaaaaaaaatattagaacaggat
cctgaatctccaggttctttaggagttgccatcagtgaggcagtggaggatgcagttaaa
agggatgacacaaaatattctcttggtagtgttttgaatcatgttttgttgcaccagaca
gtaataggtgaagaggctttattacaaatggaaatggcaggagagtttcctgatgtggtt
ataggatgtgttggtggaggaagtaattttgcaggactctcttttccttttataagagaa
aagtttaagggcaaaaagataagggttgttgctgtagagccagaatcttgcccatctttg
actaaaggagtttatacttacgattatggggatgtagcaaagatgactcctctccttaag
atgtacactttagggcataattttatacctcctgctatacatgcagggggacttcgttat
catggtatggctccccttgtaagtgctttatatcataacggatatattgaagctgtagct
tatcctcaaacaaaagtatttgaggcaggagttatatttgcaagaactgagggtattgta
cctgcaccagaatctactcatgctattagggctgctatagatgaagctttggatgcaaag
gaaaaaggagaaaagagggtaatactatttaatctaagtggacatggattttttgatctt
tctgcttatgatcagtatctctctggaaaacttgaagactatttctatccaaaagataag
gttgaagaggctttaaaagagcttccgaagatttag

DBGET integrated database retrieval system