KEGG   Dictyoglomus thermophilum: DICTH_1222Help
Entry
DICTH_1222        CDS       T00774                                 

Gene name
rdgB
Definition
(GenBank) non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:dth00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DICTH_1222 (rdgB)
Enzymes [BR:dth01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     DICTH_1222 (rdgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: ACI19419
UniProt: B5YEU3
Position
complement(1174231..1174848)
Genome map
AA seq 205 aa AA seqDB search
MDKRIIVLATKNEGKVREILEILSEYKDQIKTLKELEFDMDLPEETGKSYEENAFIKAKY
VAEITGYPVIAEDSGLEIDALQGELGIYSARFGGNVGYKEKISLVLEKMKDTPWEDRKAR
FICKAVFYDMKEDVKIITGGKVEGYIAYEPKGEKGFGYDPIFYFPLLDKTFGEIDKSEKN
KYSHRFLAFSKLKLFLDAYCKGGKI
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggataagagaattattgtattagcaacaaaaaatgaaggtaaagtgagagagatatta
gagattctttctgaatataaagatcaaataaaaactttgaaagaattggaatttgatatg
gatcttcctgaagaaacaggaaaaagttatgaagagaatgcttttattaaagcaaaatat
gttgctgagattacgggctatcctgtaattgctgaggattcaggtcttgaaattgacgct
ctacaaggggaattagggatttattccgcaagatttggtggaaatgtgggatataaagaa
aagataagtctggttttagagaagatgaaagatactccttgggaagatagaaaagcaaga
tttatatgtaaagctgtattttatgatatgaaagaggatgtaaaaatcatcacgggagga
aaagtagaaggatatattgcctatgagccaaaaggtgaaaaggggtttggttatgaccct
atattttattttccgcttcttgataaaacttttggagaaatagacaagtctgagaaaaat
aaatacagccatagatttttggcttttagtaagttaaaattatttttagatgcttattgt
aaagggggtaaaatatga

DBGET integrated database retrieval system