KEGG   Dictyoglomus thermophilum: DICTH_1253Help
Entry
DICTH_1253        CDS       T00774                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00260  Glycine, serine and threonine metabolism
dth00750  Vitamin B6 metabolism
dth01100  Metabolic pathways
dth01110  Biosynthesis of secondary metabolites
dth01120  Microbial metabolism in diverse environments
dth01230  Biosynthesis of amino acids
Module
dth_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DICTH_1253 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DICTH_1253 (thrC)
Enzymes [BR:dth01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DICTH_1253 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ACI19741
UniProt: B5YEX3
Position
1201371..1202411
Genome map
AA seq 346 aa AA seqDB search
MSGVLIRYKELLPITENTPMITLHEGDTPLIYANNLSKKYGIDVWLKYEGMNPTGSFKDR
GMVVAIAKALEEKSEMVICASTGNTAASAAAYAALTNLKAFVVLPEKAIALGKLAQAIMY
GAKIISVKGNFDDALKLVREISQKFPITLVNSINPYRLEGQKTAAFEICDVLKRNPENLA
IPVGNAGNISAYWMGFKEYYKIGKIKELPKMLGFQAEGAAPLVKGHPIPNPQTIATAIKI
GNPASWDKAINAVRESSGLIDTVSDEEILEAQKELASKEGVFVEPASAASWAGVKKLLKE
NRFPGEEVVCVLTGHGLKDPDIAIKQAKIDISIEPKIEEFQKIIEK
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcgtattaataagatataaagagcttcttcctataaccgaaaatacacctatg
ataaccctacacgaaggagatacaccattaatatacgctaacaatctatcaaagaaatat
ggaatagatgtatggcttaaatatgagggtatgaatcctacagggtcttttaaagacagg
ggtatggttgtagcaatcgctaaagccttagaagaaaaaagtgagatggtcatatgcgcc
tcgacaggaaatactgctgcctctgcagccgcttatgctgctcttacaaacctaaaagcc
tttgtagtactaccagaaaaagcaattgccttaggcaagcttgcccaggccataatgtac
ggagcaaagataatcagcgtcaaaggtaacttcgacgatgctcttaaattggtaagagag
atttctcaaaagtttcctattaccttggtaaactctataaatccctataggttggaaggg
caaaaaacagcagcttttgaaatctgcgatgttctaaaaagaaatcctgaaaacttagct
attcctgtaggaaatgctggaaacatttcagcttattggatggggtttaaggaatattat
aaaataggaaaaataaaggaattacctaaaatgcttggatttcaagcagaaggcgctgca
cctctagtgaaaggtcatcctatccccaatcctcaaactatagccactgcgataaaaata
ggaaatcctgcaagttgggacaaggctataaatgcagttagagaatcttcaggtttaatc
gatacagtttctgacgaagaaatattagaagcccaaaaagagttagcctcaaaagaaggc
gtatttgtagaaccagcctcggcagcctcatgggcaggagtaaagaaacttttaaaagaa
aatagatttccaggagaagaagtggtatgtgttctcacagggcacggtttaaaggatcca
gacatagctataaaacaagccaaaatcgatatctccattgaacctaaaatagaagaattt
caaaaaataatagaaaaatga

DBGET integrated database retrieval system