KEGG   Dictyoglomus thermophilum: DICTH_1562Help
Entry
DICTH_1562        CDS       T00774                                 

Definition
(GenBank) alpha-galactosidase AgaN
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
dth  Dictyoglomus thermophilum
Pathway
dth00052  Galactose metabolism
dth00561  Glycerolipid metabolism
dth00600  Sphingolipid metabolism
dth01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dth00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICTH_1562
  Lipid metabolism
   00561 Glycerolipid metabolism
    DICTH_1562
   00600 Sphingolipid metabolism
    DICTH_1562
Enzymes [BR:dth01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DICTH_1562
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2 GHL10
Motif
Other DBs
NCBI-ProteinID: ACI20091
UniProt: B5YAA7
Position
1501348..1503528
Genome map
AA seq 726 aa AA seqDB search
MPIIYDRDNNIFHLMAGDSSYIIKIFKNKYPVHLYWGKKLNHSHFSEAFITSPFGPNPDP
NDKSFTFDRMLLEYPSYGNSDFRHPAFQIEQEDGSRITQLVFNNYRIYKGKPKLEGLPAT
YVETEDEAETLELELIDELINLKVILFYTAYNDYNVITRSVKFINEGNQKLKILRALSTC
VDFDHCNFDLLHLWGSWARERYVERVPLMHGIKIIESSRGESSHQHNPFIALLSKDATEK
NGDVYGFSLVYSGNFAANVEVDQFNTTRVTMGINPFEFTWILDKGETFQTPEVVMVYSSQ
GIGEMSRTYHRLYRKRLVRGVYRDKRRPILVNTWEAVYFNINEEKLLSLAKEAKELGIEL
FVLDDGWFGRRDDDTSSLGDWYVDRRKLPSGLEGLGNKLKEMGLKFGLWFEPEMVSPDSE
LYCKHPDWCIQIKGRTLSQCRNQYVLDITRKEVRDEILRMMKEIIKSAPIEYIKWDMNRP
LTEVGSLALPPERQKEVFHRYVLALYEMIEELTTEFPYILFEGCSGGGGRFDPGILYYMP
QIWTSDNTDAIERLKIQWGTSIVYPASTMGAHVSAVPNHQVGRITPLKTRGYVAMSGVFG
YEMDLTKLTPEEKELVKEQIEMYKRVWYIVFEGDLYRLINPFEENSASWMFVTPDKREAF
VIYVNILAEPNPPFKKLKLDGLDPNKKYIIEGTDKEYYGDELMNIGINIPPMRDFDSFAF
ILKEKS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcatatacgatagagataataatatttttcatttaatggcaggagactctagc
tatataataaaaatctttaaaaataaatatcctgtacatctttactggggcaaaaaatta
aatcactcccatttttcagaagcttttatcacctctccttttggacctaatccagatcca
aatgacaaatcttttacctttgacaggatgctattagaatatccatcctatgggaattct
gacttcagacacccagcctttcaaatcgaacaagaagacggttctcgaataactcagctt
gtttttaataattatagaatatacaaaggcaaacctaaacttgagggattgccagcaacc
tatgtagagacagaagatgaagcagaaaccctggagttagaactcattgatgagctcata
aacctcaaagtaatcttattctatactgcttataacgactacaatgtgatcacaaggagt
gttaagtttataaatgaaggtaaccagaaactaaaaattttgagagccttaagtacatgt
gttgattttgaccattgtaattttgatcttcttcatctctggggatcttgggcaagagaa
agatatgtagaaagagtacccctaatgcatggaataaagattattgaaagttctcgtgga
gaaagttctcatcaacataatccctttatagcgctactttctaaagatgcaaccgaaaag
aacggagacgtgtatggatttagcttagtatatagtggaaactttgcagcaaacgtagag
gtagatcaatttaacactactagagtaaccatgggtataaacccctttgaatttacatgg
atccttgacaaaggagaaacctttcaaactccagaggtggtaatggtctactcatctcag
ggtataggagaaatgtctagaacctatcacagattatataggaaaagactcgtgagagga
gtatatagagacaagagaagacctatccttgtaaatacatgggaggcggtctattttaat
ataaacgaagaaaaacttctttccttagccaaagaggctaaagaacttgggattgagctt
ttcgtacttgatgacggatggtttggaagaagagacgatgataccagctctcttggagat
tggtacgtagatagaagaaaattacccagtggccttgaaggattaggaaataaattaaaa
gaaatgggacttaaatttggcttatggtttgaacctgagatggtctcaccagacagcgag
ctatattgtaaacatcctgattggtgtatacagattaaaggaagaactctttcccagtgc
aggaatcagtatgtgcttgatataacaagaaaagaagtaagagatgaaatattgagaatg
atgaaagaaattataaaaagtgcacctatcgagtatattaagtgggacatgaatagacca
ttaactgaggtgggctctttagctcttccccctgaaagacaaaaagaggtatttcacaga
tatgtattggccctttatgaaatgatagaggaattaaccacagaatttccatatattctt
tttgaaggatgctcgggagggggaggaagatttgatcctggaatcctctattatatgcct
cagatttggaccagtgacaataccgatgctattgagaggctaaaaatacaatggggaaca
agcatagtatatcctgcttccaccatgggagctcatgtttctgcagtaccaaaccatcag
gtaggaagaatcaccccactaaaaacaagagggtatgtggctatgtcaggtgtctttggt
tatgagatggacctaacaaaattaactcctgaagaaaaggaattagtgaaagagcagata
gaaatgtataaaagagtgtggtatattgtttttgaaggagatttatatcgcctaataaat
cctttcgaagaaaattcagcctcttggatgtttgtcacacccgataaaagagaggccttt
gtaatttatgtaaatatattagcggagcccaatcctcctttcaaaaaacttaaacttgac
ggcttagatcctaataaaaaatatataatagaaggcacagacaaagaatattatggagat
gaattgatgaatattggcataaatatacctccaatgagggattttgactcttttgccttt
atattaaaggaaaaatcctaa

DBGET integrated database retrieval system