KEGG   Desulfomonile tiedjei: Desti_0748Help
Entry
Desti_0748        CDS       T02147                                 

Definition
(GenBank) theronine dehydrogenase-like Zn-dependent dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Desti_0748
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Desti_0748
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Desti_0748
    1.1.1.-  
     Desti_0748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C Pyr_redox_2 AlaDh_PNT_C Pyr_redox_3 DAO Methyltransf_24 Pyr_redox TrkA_N NAD_binding_7 Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFM23473
UniProt: I4C1N2
Position
complement(854035..855093)
Genome map
AA seq 352 aa AA seqDB search
MKAAVWYGKKDVRVENVPEPPAPGPGQVKVKVHWCGICGSDLHEYDAGPIFIPAEAPHPL
TGVQAPLILGHEFSGEVVEIGEGVQNIQVGERITADACQYCGKCYMCKRNRYSVCSSLAF
TGLMANGAFADYVNVPAYTIYRLPPEMPSDVGAVVEPAAVGVHAIRRGRVLEGDTVAVVG
AGTIGLVTLQAAKAAGASKVIVLEMAQARKEYAKKLGATAVIDPSEQDAIKAVRQLTDGL
GVDVAIECVGGSETGALAVDLTRQGGKTVLVGIFEKPSEIHFNNLVFFEKEIVGSLAYYG
EFSTAIALMADGRIAAQPMITAKIKLDDIVEKGFKELLANREQHIKILVSPQ
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctgtatggtacggaaagaaggacgtgcgagtggagaatgttcccgagcct
cccgcaccagggcccggacaggtcaaagtaaaagtccactggtgcggcatctgcggctcc
gatctgcacgagtacgatgcaggtcctatcttcatccctgcggaagctcctcatcctctg
acaggtgtgcaggcacctttgattctgggtcatgagttctcaggcgaagtggttgaaatt
ggtgaaggggtccagaatattcaggttggggagagaatcaccgcagatgcctgccagtac
tgcggaaaatgctatatgtgcaaacggaaccgctacagcgtgtgcagttccttggccttc
acggggctcatggccaacggcgcttttgcagattacgtgaatgttcccgcttacaccatc
tacagacttcctccggaaatgccttctgacgtcggtgccgtcgtggagccggctgcggta
ggagtgcacgccatccggagaggccgcgttcttgagggcgacactgttgcggtggtgggg
gcaggtaccattggactggttacgctgcaggcggccaaagcagcaggggcgagcaaggtc
atcgtgctcgaaatggctcaagcccggaaggaatacgcaaagaagctcggggccactgcc
gtcatcgatccttcggaacaggatgcgatcaaggcggttcgtcaactgaccgacggactc
ggggtcgatgtggccatcgagtgtgtcggtggcagcgagacaggtgcgcttgccgtggat
ttgaccaggcaagggggaaagaccgtgctggtggggatttttgagaagcccagcgagatc
cacttcaacaacctggtcttctttgagaaggaaatcgtcggctctctcgcatactacggt
gagttcagcacagctattgccctcatggcagatggtagaatcgccgctcagcccatgatt
acagccaaaatcaagttggatgatattgtggagaagggcttcaaggagctgcttgcaaac
agggaacagcatatcaagattctcgtgtcgccacagtga

DBGET integrated database retrieval system