KEGG   Desulfomonile tiedjei: Desti_1210Help
Entry
Desti_1210        CDS       T02147                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00030  Pentose phosphate pathway
dti00051  Fructose and mannose metabolism
dti00052  Galactose metabolism
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
dti01230  Biosynthesis of amino acids
dti03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_1210
   00030 Pentose phosphate pathway
    Desti_1210
   00051 Fructose and mannose metabolism
    Desti_1210
   00052 Galactose metabolism
    Desti_1210
  Energy metabolism
   00680 Methane metabolism
    Desti_1210
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Desti_1210
Enzymes [BR:dti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Desti_1210
Protein phosphatases and associated proteins [BR:dti01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Desti_1210
Messenger RNA biogenesis [BR:dti03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Desti_1210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase TadZ_N
Motif
Other DBs
NCBI-ProteinID: AFM23923
UniProt: I4C2Y2
Position
complement(1442685..1443965)
Genome map
AA seq 426 aa AA seqDB search
MDTAIESLGVARIPSPLKHVQHVTDDECILYDSSARNVEQQIREGQTPVSFMKAGPRDFM
YFDPSKLKCAVVTAGGLCPGLNNVIRAIVLTLYYSYGVRNVLGIRYGFQGLVPQYGHPIL
ELTPKSVGDIAELGGTVLGSSRGPQSVEDMVDALERMNVGILFAIGGDGTMRAVSKICEG
IRNRNAKISVIGIPKTIDNDISYMSRSFGFNTAVTVAAEVITAAHVEATGSPNGIGLVKL
MGRRAGFIASYAALAKRDANFVLIPESDFDLEGPHGFLAVLEKRILDRKHAVIVVAEGAG
QQYAHGEGTDESGNPRLGDIGIFLKEAIDEYFKGKGIELNLKYIDPSYTIRSVEATSDDA
IFCTFLAQNAVHAGMAGKTNMVVGNWRDEYVYIPVDLVITGRKQVELDGKLWSSVLEATG
QPSFKP
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggataccgcaatagaaagcctgggagttgctcggatcccctcaccattaaagcatgtt
cagcatgtaacggatgatgaatgcattctctacgattcctctgcaagaaacgtggagcag
caaattcgagaaggccaaacgccagtctctttcatgaaggccggtcccagagactttatg
tatttcgacccgagcaagctcaaatgcgcagtagtaacggccggtggcttgtgtcccggc
ctgaataacgttatccgggctatcgtcctgacactgtattactcgtacggcgtacgaaat
gtcctgggaatacgatatggtttccaggggcttgttcctcagtacggacatcccatactg
gagcttaccccgaagtctgtgggagacattgcggaactcggtggaacagtgctcggatcg
tctcgaggacctcaaagcgtcgaagacatggtggatgcactggaacggatgaatgtcggc
attctcttcgccattggcggagacggcaccatgcgggctgtctccaaaatctgcgaaggg
ataagaaatcgcaatgcaaagatatccgtcataggaatccccaagacgatagataacgat
atcagttacatgtctcgctccttcggtttcaacactgctgtgacagtagctgctgaagtg
attaccgccgcacacgttgaagctaccggttctccaaatggtatcggactggtaaaactc
atgggacggcgcgcggggttcattgcctcatacgccgctttggccaagcgggacgcgaat
tttgttctcatcccggaatccgatttcgacctggaggggccccacggattcctggctgtc
ctggaaaaacgaattctcgaccgcaagcatgccgttatagtcgtagccgaaggtgcagga
cagcagtatgctcacggtgaaggcacggatgaatcaggaaatccgcgcctgggcgatatc
ggaattttcctaaaagaagcgatagacgaatatttcaaaggaaaaggcatcgaactgaac
cttaaatacatcgatccgagctatacgattcgttccgtagaagccacttcggatgacgcc
atcttctgcacgtttctggctcaaaacgcggtgcacgcaggaatggccggtaaaaccaac
atggtagtaggtaactggcgcgacgagtatgtttacattcctgtggatcttgtgataaca
ggacgtaaacaggtggagctggatgggaaactctggagcagtgtcttggaggctacaggt
caaccatcctttaaaccataa

DBGET integrated database retrieval system