KEGG   Desulfomonile tiedjei: Desti_1637Help
Entry
Desti_1637        CDS       T02147                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00071  Fatty acid degradation
dti00072  Synthesis and degradation of ketone bodies
dti00280  Valine, leucine and isoleucine degradation
dti00310  Lysine degradation
dti00362  Benzoate degradation
dti00380  Tryptophan metabolism
dti00620  Pyruvate metabolism
dti00630  Glyoxylate and dicarboxylate metabolism
dti00640  Propanoate metabolism
dti00650  Butanoate metabolism
dti00900  Terpenoid backbone biosynthesis
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
dti01212  Fatty acid metabolism
dti02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Desti_1637
   00630 Glyoxylate and dicarboxylate metabolism
    Desti_1637
   00640 Propanoate metabolism
    Desti_1637
   00650 Butanoate metabolism
    Desti_1637
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Desti_1637
   00072 Synthesis and degradation of ketone bodies
    Desti_1637
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desti_1637
   00310 Lysine degradation
    Desti_1637
   00380 Tryptophan metabolism
    Desti_1637
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desti_1637
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desti_1637
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Desti_1637
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dti04147]
    Desti_1637
Enzymes [BR:dti01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Desti_1637
Exosome [BR:dti04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Desti_1637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFM24348
UniProt: I4C457
Position
complement(1952483..1953688)
Genome map
AA seq 401 aa AA seqDB search
MATGIKDKVAIIGMGCTRFGERWDVGAEELMVEAFTECLGDAGVEPKDIQAAWLGTCLEE
VNVGKSGLPLSVTLRLPLIPVTRVENFCASGTESFRGAVYAVASGAYDMCLAMGVEKLKD
TGYGGLPNPGSNWGSLSWLWWPNVTAPGAFAQLATAYAAKYKIPEQDLKRAIGHVSVKSH
ANGALNPKAHLRKPVTLDQVLSAPIIAHPLGLFDCCGVSDGAACAIVTTVEKAKEMGKKD
FVTVKALQLALSSGEEMGYNNWDGDHFITTSQASIRAYEEAGIKAPRKEISMMEVHDCFS
ITELVTYEDLHISERGRAVYDSLDGFYDREGKGVPCQVDGGLKCFGHPIGASGLRMLYEM
YLQLHGRAGARQIPNPRYGLTHNLGGVPFMNVCSIGIIGKY
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcaacaggaatcaaagacaaagttgcgattataggcatgggttgcacccgattcggc
gaacgctgggatgtgggagccgaagagctcatggtggaagcattcaccgaatgccttgga
gatgcaggagtcgagcccaaggacatacaggctgcatggcttggaacgtgcctcgaagaa
gtgaatgtgggtaaaagcggcttaccgctgtccgtgacccttcgacttccccttatcccc
gtgactcgggtcgagaatttttgtgcgagcggcacagaatcatttcgcggtgcagtgtac
gcggtcgcttccggtgcgtatgacatgtgcctggcaatgggagtggagaaactcaaagat
accggttacggaggactcccgaatccgggctccaactggggttccctgagctggctgtgg
tggccgaacgtgacagctcccggggctttcgcgcaactcgccactgcgtacgcggcaaaa
tacaagatccccgaacaggacttgaaaagagcaatcgggcatgtttccgtgaagagtcat
gcaaacggagcactcaatcccaaagcgcatcttcgaaaaccggtgacgctcgatcaagtc
ctgtctgctccgatcattgcgcatcctctggggcttttcgattgttgtggcgtcagtgac
ggagcagcctgcgccattgtgaccaccgtggaaaaagcaaaggaaatgggcaagaaagat
tttgtgaccgtgaaggcgcttcagcttgccctcagcagcggcgaggaaatgggctataac
aactgggatggagaccacttcattaccacgtctcaggccagcattcgggcttatgaagaa
gccgggataaaagccccccgcaaagaaatcagcatgatggaggtgcacgactgcttttcc
atcactgaattggtcacgtacgaggacctccatatctccgagcgcgggcgtgcggtatac
gactctcttgacggcttttatgacagagaaggcaagggagttccctgtcaggtagatgga
ggcctgaagtgcttcggtcatcccatcggagcatcgggattgcgaatgctctacgaaatg
tatctccagcttcacggcagggccggagcacggcaaattccgaaccccaggtacgggctc
acccacaatctgggcggcgttcctttcatgaacgtctgtagcattggaattattgggaag
tattag

DBGET integrated database retrieval system