KEGG   Desulfomonile tiedjei: Desti_2396
Entry
Desti_2396        CDS       T02147                                 

Definition
(GenBank) aerobic-type carbon monoxide dehydrogenase, large subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00230  Purine metabolism
dti01100  Metabolic pathways
dti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desti_2396
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Desti_2396
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFM25079
UniProt: I4C688
Position
complement(2851596..2854007)
AA seq 803 aa
MGKYVGKSINRLDGVQKVTGSATFASDMIAPGMLFGKILRSPHPHARVLKVDASEAEKLP
GVKAVIHRGNVPNNPFNTAAPMYLTVPYLKPVLDQQIFSEKVRFVGDEVAAVAAISEKIA
AEACRLIKVEYEVLPAVFDIQEALAEDAPEIHDPKITPEGKNIVAEIIRLPPGPPSDDVE
KAFEKADVIIEEEFNINIVKQCQMETMAALAVVEPDGKINVISTTQTPHPARAILAKVFG
VPASKIRVSNPPFVGGGFGVRIGLSAKAEIMAVALSLAAKKPVKVVYTREEDFLATDTRH
GAIVRVKLGAMKDGTFVALDLKGYTNTGAYCTFGAELPGVLGAMTLAIYNIPAIRYYGHS
VYTNCTHAGAMRGFGNPQGNFPLERVVDMMAEKLNIDAKDLREKNIMKAGEPWFLPYPCS
SSELAECIKRCAESIGWERRGKFKNNSGTIRRGLGMAVGTHVSNAWPFCVDYDNAYVAVQ
QDGSVNLSVGCCDMGTGTSTCLPQVCAETLGIKFEDLTFTFGDTASTPFTIGNHASRGAY
AQGITVKAAAEDARKQILEYAAPLFKVSPGELTIEDSIIKKLTSSGEDVTVVDPATLPGA
IEEAQAAPVPPPVDHEMISPVNTTGAQQGISLEGLSYYAHIRNKQFLGIGRTIPFNAPPW
HCCAAEVEVDMELGTVQVIKMAAAHDVGTAINPKIVEGQIEGGVVQGIGFALNEEILYKP
NGHQAHTSFSAYMLPTAEDIPEIDAIIVAGNDPSGPYGAKGVGECGLVCPASAIANAVAD
ALGAKVNELPMTAERVYELIRKA
NT seq 2412 nt   +upstreamnt  +downstreamnt
atgggaaaatatgtcggaaaaagcatcaacagactggacggagtgcaaaaggttacggga
tcggcaacgtttgccagtgacatgattgcgccaggtatgctttttggcaaaatcctgaga
agcccccatcctcatgccagagtactcaaagtcgacgccagcgaagctgagaaacttcca
ggtgtcaaggcggtcatccatcgtggaaacgtgccgaacaatcctttcaatactgccgcc
cctatgtacctgacggttccttacctgaaaccggtgttggatcaacagatattttccgag
aaggttcgctttgtgggagatgaagtggccgctgtggccgccatatctgaaaaaatcgct
gcagaggcgtgcaggctgatcaaagtcgagtatgaagtgctaccagcagtatttgacatt
caagaggcactggctgaggatgcgccggagatccacgatcccaagattaccccggaaggg
aagaacatcgttgcggagatcatccgtctacctcccggcccgccaagcgacgacgtcgaa
aaagcatttgagaaggctgacgtcatcatagaggaagagttcaacatcaatattgtgaag
caatgccagatggagactatggctgccttggccgtggtggagcctgatggcaaaatcaat
gtgatttcaaccacccagacacctcatcctgccagagcaatcctggcaaaggttttcggt
gttccggcgagcaagatcagggtgagcaacccgccttttgtcgggggtggtttcggcgtt
cgtatcggtctgagtgccaaagcggaaattatggccgtagcgctgtccctggccgccaag
aagcctgtgaaagtcgtatacaccagagaagaagactttttggccacagacaccaggcat
ggtgccatcgtacgtgtgaaattgggcgccatgaaagacggtacttttgttgccctcgat
ctgaaaggttatacgaacacaggcgcatactgtactttcggcgcggagcttccgggcgtt
ctgggcgctatgacactagccatctataacattcccgccattcggtattatggccacagc
gtgtacacgaactgcacccatgcaggagcgatgcggggttttggcaatccccagggcaac
tttccattggaacgggtagtagacatgatggctgagaagctcaacattgatgccaaggac
ctccgcgaaaagaatatcatgaaagccggcgagccttggttcctgccttacccatgcagc
agttccgaactggctgaatgtatcaaacgttgcgcagagagcatcggctgggaacgccgc
ggcaaattcaagaacaattctggtaccattagacgcggacttggtatggcggtggggact
catgtttccaatgcttggcctttctgcgtcgattatgacaatgcttatgtggccgtgcag
caggacggttccgtaaacctgtcggtgggctgttgtgacatgggcaccggtaccagcacc
tgtctgccccaggtatgcgctgagacactggggataaaattcgaagacttgacatttact
ttcggggatacggcatccaccccattcaccatcggcaaccatgcgagccgaggcgcttat
gcccagggaattacggtcaaggcggctgctgaagatgccagaaagcagattttggaatat
gcggcacccctattcaaagtgtcccctggagagttgacgatcgaagactcaatcatcaaa
aagctgacctcctcaggcgaggacgtaaccgtagtcgatccagccactctgcccggcgcc
atcgaagaggcccaggccgcacctgttcctccgccagtggatcatgaaatgatcagcccc
gtgaacactacaggtgcccagcaagggatatccctggaaggcttgagctattatgcccac
atacgaaataagcaatttctcgggattggcaggactatcccgttcaacgctcctccctgg
cactgctgcgcggccgaagtggaagtggatatggaactggggacggttcaggtgatcaaa
atggctgcggcgcatgatgtcggcacagccatcaacccgaagattgtagaaggacagatt
gaaggaggcgtcgtccaggggatcggctttgcactgaatgaagagatcctgtataaaccc
aatggacatcaggcacacaccagcttctccgcctatatgctgccgacggccgaggatatt
cccgagatagatgccataattgtggcaggcaatgatccttcaggtccttatggcgccaag
ggcgtcggtgagtgcggcctcgtttgtccggcatccgccattgccaatgccgtggccgat
gcgctgggcgcaaaggtcaatgaattgccgatgacggccgaacgcgtttacgaactgatc
cgcaaagcttga

DBGET integrated database retrieval system