KEGG   Desulfomonile tiedjei: Desti_2909Help
Entry
Desti_2909        CDS       T02147                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00340  Histidine metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Desti_2909
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Desti_2909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFM25578
UniProt: I4C7N7
Position
3418308..3419615
Genome map
AA seq 435 aa AA seqDB search
MKVNFFELSKMNSGERAKLCRRTGVDLRDLKIRVTPILDAVRDRGNEAVREYTARFDGVD
LEPDLFRVSLEDMDHARDSLPQDLKEAMEVSIRNIRVFHERQVEPPSWEMEISPGIIAGE
RIVPIASVGLYVPRGKGSFPSMMMMSGVPAKVAGVPRIVVVTPPDRHGKADAATIAAARM
IGIDEVYALGGVQAVAALAYGTETIEKVDKIVGPGSGYVLAAKQLLSTEVDTGLPAGPSE
AIVLADDSADPLMVVTDLLIEAEHGPDSAAYLVTHSPILASKALELIPQLVADLPEGRRS
YCQEVFRTNGGVVLAEDMDDALDFVNRFAPEHLQILTHNPSATLDKVQYAGEALLGEFTP
GTLANYSIGPNAILPTSGFARTASALSVRDFTRRMSYSQVTEAGFRDLAPKTLTLARYEG
FAAHAAALTHRMQKK
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttaactttttcgaactgagtaagatgaattccggggagcgagcgaagctgtgt
cgcagaacgggtgtggatctgagagatctcaagatcagggtgactccaattctggatgca
gtccgtgaccgaggaaatgaggccgtcagggaatacactgctcggttcgatggcgtggat
ctggaaccagatctgttcagggtttctcttgaagacatggaccacgcgagggattcgctt
ccacaggaccttaaagaggcaatggaagtctctattcgcaatatccgcgtgtttcatgag
cgccaggtggagcccccatcatgggaaatggagataagtccgggaattatcgcaggcgaa
cgcattgttcccatcgcttccgtgggattgtacgttcctcgaggcaagggttcgtttcct
tccatgatgatgatgtccggagttcctgccaaagtcgcgggagtaccgagaattgtagtg
gtcactcccccggatcgacacggtaaagccgatgcagcaaccattgccgctgcacgtatg
atcggcattgacgaagtgtatgcgcttggcggagtgcaggctgtggcagcacttgcctac
ggcacggaaaccatcgaaaaggtcgataaaatagtggggcctggttcgggatatgttctc
gcagcaaagcagctcttgtctacagaggtcgatacgggccttccggcaggccccagtgag
gcgatagtgctcgcggacgattctgccgatccgctcatggtcgttaccgacctgctcatc
gaagcggaacacggaccggattccgccgcgtatctcgtgacacacagccctatccttgcg
tccaaggctctggagcttattccgcaattggttgcagacctacccgagggcaggcgttcc
tactgccaggaggtgttcaggaccaatggtggagttgttcttgccgaggacatggacgat
gctctcgattttgtaaacaggtttgctcctgaacacctgcagattcttactcacaaccct
tcagcgacattggacaaggtccagtacgcgggtgaagcgctgctgggcgaatttactccc
ggaacactggccaactattccatcggaccgaacgcgattcttccgacgtccgggtttgca
cgaacggcttctgctctgtcggtccgtgacttcacgcgccggatgtcctactcccaggtg
actgaagcgggttttcgggatctcgcacccaaaactttgactctggccaggtacgaggga
ttcgctgcacatgcagcagccctgacacaccgaatgcagaagaaatga

DBGET integrated database retrieval system