KEGG   Desulfomonile tiedjei: Desti_3010Help
Entry
Desti_3010        CDS       T02147                                 

Definition
(GenBank) enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00071  Fatty acid degradation
dti00280  Valine, leucine and isoleucine degradation
dti00281  Geraniol degradation
dti00310  Lysine degradation
dti00360  Phenylalanine metabolism
dti00362  Benzoate degradation
dti00380  Tryptophan metabolism
dti00410  beta-Alanine metabolism
dti00627  Aminobenzoate degradation
dti00640  Propanoate metabolism
dti00650  Butanoate metabolism
dti00903  Limonene and pinene degradation
dti00930  Caprolactam degradation
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Desti_3010
   00650 Butanoate metabolism
    Desti_3010
  Lipid metabolism
   00071 Fatty acid degradation
    Desti_3010
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Desti_3010
   00310 Lysine degradation
    Desti_3010
   00360 Phenylalanine metabolism
    Desti_3010
   00380 Tryptophan metabolism
    Desti_3010
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Desti_3010
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Desti_3010
   00281 Geraniol degradation
    Desti_3010
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Desti_3010
   00627 Aminobenzoate degradation
    Desti_3010
   00930 Caprolactam degradation
    Desti_3010
Enzymes [BR:dti01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Desti_3010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AFM25675
UniProt: I4C7Y4
Position
complement(3534240..3535010)
Genome map
AA seq 256 aa AA seqDB search
MDVVIEKNGSVWTIIMNRPDRKNAVDRNMADRLADAFRSFEADSHALVSVLWGAGGCFCA
GADLKALARGDRNRLNTDMTADGPMGPTRMRLSKPVIAAVSGFAVAGGLELACWCDLRVL
EKDAVLGVYCRRFGVPLIDGGTQRLPRLIGLSRAMDMILTGRSVSAEEALSMGLANYVVE
TGKSREEAENLANRIARYPNRCLRSDREAAYRGFDLPFDQAMDLEFRLGLQVIESGESEQ
GAVKFSQKQEDAKRFF
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgtgatcgaaaagaacgggtccgtttggaccattataatgaaccgtccggat
cgtaagaatgctgtggacagaaacatggcagatcggcttgcagatgcttttcggtcgttt
gaagccgacagccatgcactggtatcggttctctggggagcaggaggctgtttttgcgct
ggagccgatctaaaagctctggctcgtggcgataggaatcggctgaatactgatatgact
gcagacggccctatggggccgacccgtatgcgtctttccaaaccggtcattgcagccgta
tccggttttgccgtggccggtggtttggagcttgcgtgttggtgcgatctgagggtcctg
gaaaaggacgctgttctgggagtgtactgtcgcaggtttggcgttcctttgatagatggg
ggcactcaaagacttcctcgtctcattggactgagtcgggctatggacatgattctcaca
ggcagatccgtgagcgctgaagaggccctgtcaatgggattggctaattacgtggtggaa
acggggaaatcccgtgaagaggctgaaaatcttgccaacaggattgctcggtacccgaac
cggtgcctcagaagcgaccgggaggcagcgtatcgtggcttcgatttaccattcgaccag
gccatggatcttgaattccgtttgggattacaggtgatcgagagtggagagagcgaacaa
ggagccgtgaagttttctcagaaacaggaagatgcgaaacgcttcttctga

DBGET integrated database retrieval system