KEGG   Desulfomonile tiedjei: Desti_3063Help
Entry
Desti_3063        CDS       T02147                                 

Definition
(GenBank) putative metal-dependent phosphoesterase, PHP family
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dti  Desulfomonile tiedjei
Brite
KEGG Orthology (KO) [BR:dti00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Desti_3063
Enzymes [BR:dti01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Desti_3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: AFM25726
UniProt: I4C835
Position
3601774..3602631
Genome map
AA seq 285 aa AA seqDB search
MIDLHVHTNMSDGTFSPAEVVKRAASLGLRAIAITDHDTVSGVEQATEQGQISGVEIVPG
LEISADWDKGILHVLGYFMDQENEALVSALDFLQTGRRERIPRILAKLKENSDILVSQEA
IDREAAGGVPGRPHVAKVMVREGLVETMQEAFDRYLGKGTPAYVKKAKLPASTAIRVICE
AGGIPVLAHPYSLGSENEASLIETVTVLMDSGLQGIEAFYPKHTLRQTEIYLSVASRFGL
TVTGGTDFHGEVKPDIELGQFPQYPPMDYSILESLKSRLLSRENS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgatagatcttcatgtacacacaaatatgtctgacgggactttttctcccgctgaggtg
gtaaagcgagcagcaagtctcggattgagagccatagcgattaccgatcacgatactgtt
tcgggagtcgagcaggcgaccgaacagggacagataagcggcgtcgagatagtccccgga
ctggaaatcagcgcggattgggataagggaattctccatgttctcggttatttcatggac
caggagaatgaggcactggtttcggctctggattttctccagacaggacgtcgagaacgg
attcctcgtatattggccaagctcaaagagaacagcgatatacttgtctcccaagaagct
attgaccgggaggccgcaggaggcgttccgggccgacctcacgtggcgaaagtcatggtt
cgtgaaggccttgtcgagacaatgcaggaagctttcgacagatatttagggaaaggcacg
cctgcatacgtgaaaaaggcgaaactgccggcatccacggcaatcagggtcatttgcgaa
gcaggtggcattccggtcctcgcgcatccgtattcgctcggatccgagaacgaagccagc
ctgatcgagactgtcaccgttcttatggacagcgggttacagggaatagaagcgttctat
ccaaaacacactcttcgtcagacagaaatctacctcagcgtggcatcccgatttgggctc
accgttaccgggggcaccgactttcacggagaagtcaaaccggatattgaattaggacag
tttccgcagtacccacccatggattattcgattcttgaatcattgaaatccaggcttctt
tcccgagaaaattcctga

DBGET integrated database retrieval system