KEGG   Desulfomonile tiedjei: Desti_3346Help
Entry
Desti_3346        CDS       T02147                                 

Definition
(GenBank) Adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00230  Purine metabolism
dti00250  Alanine, aspartate and glutamate metabolism
dti01100  Metabolic pathways
Module
dti_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Desti_3346
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Desti_3346
Enzymes [BR:dti01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     Desti_3346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AFM26002
UniProt: I4C8W1
Position
complement(3939523..3940812)
Genome map
AA seq 429 aa AA seqDB search
MSTLVIVGTQWGDEGKGKVVDLLTGRAEVVVRFQGGNNAGHTLKVGGEQIIVHLIPSGIL
YPDTLNIIANGMVVDPSVLLHEKETLRERGYFQQDKQLIISDRAHVIMPYHKAIDLGREE
ILGNSRIGTTGRGIGPCYEDKASRMGIRVGDLLRPDVLTRRVRIALEEKNFLIQHRFNLP
KIDADQVIEQYLDYGQQLLPHIMDASHILHTRISEGSRVLFEGAQGTLLDIDHGTYPYVT
SSNVVAGNVCCGSGVSPTRIENVWGVVKAYSTRVGAGGFPTELNDELGEQIRKIGAEFGA
TTGRPRRCGWLDLVVVNHSVRLNGLTGIALTKMDVLTGVNPIRICTSYELDGKAVDRVPA
NIEDLNRVVPKFREVKGWDEPLSYCRSFDDLPKNARDYVETIEHLTGTPVNLISVGPARE
QSILRKSPF
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
ttgagcactcttgttatagtaggaactcaatggggcgatgaaggaaaagggaaggtggtg
gatctcctcacgggccgtgcggaagtggtcgtgagattccagggcggaaacaacgccggc
catactttgaaagtcggcggcgaacagataatcgtgcatctcattccgtccggaatactg
taccctgacactctcaacataattgccaacgggatggtcgtggatccgtccgtactcttg
cacgaaaaagagaccctgcgcgaaaggggctattttcaacaagataaacaactgatcatt
tccgatagagcccatgtgatcatgccttatcataaggctatcgatctgggcagggaagag
attctcggaaactccaggatcggaaccaccggccggggcatagggccctgttacgaagat
aaagcgtctcgtatgggaatacgggtaggggatctgctcaggccggatgtcttgacccgg
agagtgcggattgctctagaggagaagaattttctcattcagcacaggttcaatcttccc
aagatcgatgccgatcaggtgatcgaacaatatttggattacggtcagcaattgctgccg
catatcatggacgcttcgcacatcctgcacacccgaatttccgaaggcagccgggtgctt
tttgagggtgcacagggaaccctcctggacatcgatcacgggacgtatccatacgtcaca
tcctcaaatgtggtggcaggcaacgtatgctgcggcagtggagtgagccccacgaggatt
gaaaacgtctggggagtggtaaaggcatattccacaagagtgggagccggcggttttccg
acggaattgaacgacgaactgggcgaacagattcggaagatcggcgcggaattcggcgcc
acgacgggcagaccccgcaggtgcggatggctcgacctggtagtggtgaaccacagcgtg
agactcaacgggttaaccggcatagcactcaccaaaatggacgtgcttacaggggtcaat
cctattcgcatctgtacatcgtatgaactcgacggcaaggccgtggacagggttcctgca
aatatagaggacctcaatcgggtagtccccaaattcagagaagtcaaaggatgggacgaa
ccgctttcctactgcagatcttttgacgatctgcccaagaacgcacgggattacgttgaa
acaatcgaacatctcaccgggactcctgtgaacttgatttccgtggggccggccagagag
cagagtattcttcgcaaatctccattttga

DBGET integrated database retrieval system