KEGG   Desulfomonile tiedjei: Desti_3978Help
Entry
Desti_3978        CDS       T02147                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00900  Terpenoid backbone biosynthesis
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
dti01130  Biosynthesis of antibiotics
Module
dti_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Desti_3978
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Desti_3978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C
Motif
Other DBs
NCBI-ProteinID: AFM26620
UniProt: I4CAM9
Position
4639411..4640568
Genome map
AA seq 385 aa AA seqDB search
MKGLSILGSTGSIGIQTLDIVRLHPDRFKVCSLAAGSNIDLLEQQIREFHPALVSCASPQ
GAADLQKRLSKRDPRPTIVTNAEIAATAEGVDLVIGGLPGSAGLVPSFAAVRAGKDIALA
TKEVLVMAGDLFMRTAREMAVNVLPVDSEQSAIFQCLQGNGESEIRRILLTASGGPFRDM
PVSDMAEVTAAQALQHPRWKMGPKVTVDSATLMNKGLEVLEARWLFDLKPSQIEVVIHPQ
SIVHSMVEFMDGSILAQLGATDMRIPISYAMAYPERIASGTEPLSFPNVRNLTFMEPDME
KFPLLKAAFDVLEKNDTAASIILNAADEVAVELFLAGKIPFLHIHKIVLDALDSIPTEKT
NTLEEVMAFHEEVVGQVRDRCASLL
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggcctttccatcctgggctctaccgggtccatagggattcaaacactcgatatc
gtcagattgcatcccgaccgctttaaagtatgctcacttgcggccgggagcaatatcgac
ctcctcgaacagcagatccgtgaatttcatcctgctttggtttcctgtgcatcgcctcaa
ggagcggctgatctgcagaaacggctgtcaaaacgcgatccccgaccgaccatagtcaca
aatgcagaaatcgcagcaactgccgaaggtgtagatctcgtcattggcggacttcccggc
agtgccgggcttgtcccgagctttgctgcagtgcgtgccggaaaagatatcgctcttgcc
acgaaagaagtccttgtcatggcgggggacctcttcatgcgaaccgcccgcgagatggcg
gtgaacgtcctgcctgtggactcggaacaatccgcaatttttcaatgtttgcaaggaaat
ggtgagtctgaaatcagacgcattctccttactgcatccggtgggccattccgggacatg
cctgtttcagatatggctgaagttaccgcggctcaggcgctgcaacatcccaggtggaaa
atgggacccaaagtcaccgtagattctgcaacgctcatgaacaaaggtctcgaggtcctt
gaagcacggtggctgtttgacctgaaaccttctcagatcgaggtggtgattcatccccaa
agcattgttcattccatggtggagttcatggacggttcgatcttggcgcagctcggtgcg
acagatatgagaattcccattagctatgcaatggcatatcctgaaagaattgcatcggga
actgaaccgttgagcttcccaaacgtccggaaccttactttcatggaaccggatatggaa
aagttcccgctccttaaagctgctttcgacgtgctcgaaaaaaacgatactgcagcttcc
atcattctgaatgctgccgatgaagttgcagtggaactgttcctcgcgggcaaaattccc
ttcctccacatccacaagatcgttcttgatgcactcgattccattcccaccgaaaaaacg
aacacgctcgaggaagtaatggcttttcatgaagaagtggtgggtcaggtgcgagacaga
tgcgcctcattgctgtaa

DBGET integrated database retrieval system