KEGG   Desulfomonile tiedjei: Desti_3991Help
Entry
Desti_3991        CDS       T02147                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00860  Porphyrin and chlorophyll metabolism
dti01100  Metabolic pathways
dti01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Desti_3991
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     Desti_3991
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     Desti_3991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO FAD_oxidored Pyr_redox_2 FAD_binding_2 FAD_binding_3 AlaDh_PNT_C Thi4 HI0933_like MCRA GIDA Pyr_redox 3HCDH_N NAD_Gly3P_dh_N Pyr_redox_3 ApbA NAD_binding_9 UDPG_MGDP_dh_N TrkA_N NAD_binding_2 Lycopene_cycl Rossmann-like
Motif
Other DBs
NCBI-ProteinID: AFM26632
UniProt: I4CAP1
Position
complement(4655028..4656362)
Genome map
AA seq 444 aa AA seqDB search
MCAEIAVIGAGIAGLAAAHFLSRAGHHVVVFEKNSFAGGRMSSEVVDGFVVEKAAYTYPE
FHRNLTKFLGDLGTGNALVETPGTSSTFARGREYQIKIGSPKDFFTYKLLSLRNKKDMVK
LFLYAQSLGAALNLADPTAKTLELEQESSADYLLTHYDEDILELIAYPIFCEIFLGTPEG
NSKLAFLSTIKNLTRFKIFSFERGMGMLPERLAATLDVRLSTPVLDVRRAAGRNAYAISV
GGDRSGTNLYDAVILAIPAPIVPLLCPDLSAEIKTRLNAIVYAPSIVAVFALSRVREGTS
MISNLVRKDFKTVGTLVFDRHKGMSHVPDGKEMITAILCEDASRALFDAPDDAVERAALA
EISGLYPGLSEQVLFSRVYRWEHGAVQLPPGAVSRSHSLRKALEEQYDDLIIAGDGLYKS
SLEVSFNSGVKAAERLIRKFGRLQ
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgaaattgccgttattggcgcaggaattgccggcttggctgctgcgcacttc
ctgagccgcgccggccatcatgtcgtagtcttcgagaagaattctttcgctggcggccga
atgagttctgaggttgtggacgggttcgttgtcgagaaggctgcctatacctatccggaa
tttcaccggaatctcacaaaatttcttggagacctcggcacaggtaacgcgttggtagag
acacccggtacatcatccacgtttgcccgaggtcgcgagtatcagatcaaaatcgggtca
ccgaaagatttctttacgtacaaacttctctcgttacgtaataagaaagacatggtgaag
ttgttcctttacgcacagtcactcggtgcagcgttgaaccttgcagacccgacggcaaaa
accctcgaattggagcaggaatcgtcagccgactacctgctcacccactatgacgaagac
atcctcgagttgattgcataccctattttctgtgaaatcttcctcggtactccggaaggc
aactccaaacttgcctttctctctactatcaagaatctcactcgatttaagatattttca
ttcgaacgcggtatgggtatgctgccggaacgacttgcggcaactttggatgtgcgtctc
tctacgccagtcctggatgtgcgccgtgcggccggacgaaatgcgtacgcaatctcggtt
ggtggagatagatcagggacaaatttgtatgatgctgttattctcgcgattccagcaccc
attgtcccgctgctctgtcccgacttatcagccgagataaagactcgcctgaacgcaatc
gtgtacgctccatctatagtggcggtattcgctctgagtagagtgcgtgagggcacgtcg
atgatctcaaatctggttcgaaaggatttcaaaactgtagggaccctggtttttgaccgt
cacaagggaatgtcgcacgtgccggacggcaaggagatgatcacagcaatcctttgcgaa
gacgcgagtcgcgctttattcgatgcacctgacgatgcagtggaacgcgcagcgctcgcc
gaaataagcggtctatatcccggcttgtcagaacaggtgcttttctcgcgggtatatcgt
tgggagcatggagcagttcaacttccacccggagcggtttcccggtcccattcgctaagg
aaagcccttgaagagcagtatgacgatctgattattgcaggcgacggactgtacaagtcg
agtctcgaagtgagcttcaactcgggtgttaaagctgcagaacgattgatccgcaagttc
ggacggttacagtga

DBGET integrated database retrieval system