KEGG   Desulfomonile tiedjei: Desti_5449Help
Entry
Desti_5449        CDS       T02147                                 

Definition
(GenBank) tetrahydromethanopterin S-methyltransferase, subunit H
  KO
K00584  tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01120  Microbial metabolism in diverse environments
dti01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dti00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Desti_5449
Enzymes [BR:dti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.86  tetrahydromethanopterin S-methyltransferase
     Desti_5449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MtrH
Motif
Other DBs
NCBI-ProteinID: AFM28035
UniProt: I4CEP4
Position
complement(6272089..6273000)
Genome map
AA seq 303 aa AA seqDB search
MADYRPVKIGDLTIGGSLGATSGLVVGSIFYDKHSIVSDVFAGEFDEKRAARLVDRVNTL
SERYGVQMAFDVIAASSEAMGRFLEFVGARTRLPLLINSTEAEVRLAGLEAATKLGILDR
CIYASLNEDTEGAEIEALGRHLPATVLILASNIDNPTPEGCCEMIETLFHPMLKEIGCSV
PIVDVGTMDPPSIGLNLREIQSVRERFGYPAGCAFSNAFSQWTALYQLGREWIDLSLATA
LVACRAAGGDFLHYGIIEKATMAAHVAATAEVFYGFAAQELDGQNLSQGHALWKMFKLSP
DRK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttggcagactatcgcccagttaagatcggagacctaaccataggagggtcactgggggct
acatcgggccttgttgtaggaagtattttctacgacaagcactcgattgtttctgacgtc
tttgcaggcgaatttgacgaaaagcgtgcggcaagattggtggatcgggtgaacacgctt
tcagaacgctacggcgtgcagatggcttttgacgtcatcgccgcgtcttcggaagccatg
gggagattcttggaattcgtcggcgcacgcacaaggcttcccttgttgatcaactccacc
gaggctgaggtacgtctcgccggactggaagccgctaccaaactcgggattctggatcgg
tgcatctatgcgtcgctcaacgaagacacggaaggagcagaaattgaggcactgggacgc
catttgcctgcaacggtcttgatccttgccagcaacatcgacaaccccacacctgagggt
tgttgcgaaatgatcgagactctttttcatccgatgttgaaagagattggctgttcggtc
ccgattgtcgatgtgggcacgatggaccccccatccatcggactgaacttgcgggaaatc
cagtcagtacgcgaacggttcggttatccggctggctgtgcgttctccaatgccttttcg
caatggacagccttgtaccaactaggtcgggagtggatcgatttgtccttggcaaccgca
cttgtggcgtgccgtgcggcgggaggggattttttgcattacggcatcattgagaaagcc
accatggctgcccatgtggccgccacagcggaagtcttctatggctttgcggcccaggag
ctggacggccagaatttgtcacaaggacacgcactatggaagatgttcaaattgtcccca
gacaggaagtga

DBGET integrated database retrieval system