KEGG   Desulfomonile tiedjei: Desti_5582Help
Entry
Desti_5582        CDS       T02147                                 

Definition
(GenBank) uncharacterized protein involved in tolerance to divalent cations
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
dti  Desulfomonile tiedjei
Brite
KEGG Orthology (KO) [BR:dti00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Desti_5582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CutA1 Herpes_LAMP2
Motif
Other DBs
NCBI-ProteinID: AFM28163
UniProt: I4CF22
Position
complement(6443364..6443690)
Genome map
AA seq 108 aa AA seqDB search
MNPFIICIVTIDDMEKAALIARVLVEKKLVACVNIVPQIRSIYSWKGQIYDESECLMIMK
TRRELFGKLQTAAKELHPYEVPEIIALEIAEGLPAYLSWIDESTRPKF
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccttcataatatgcatagttacgattgacgacatggagaaagccgctctgata
gcgcgtgtcctggttgaaaaaaaattagttgcctgtgtcaatattgttcctcaaattcgc
tcaatttattcttggaaaggacaaatatatgatgaatctgaatgccttatgattatgaaa
actcggcgtgagctttttggaaaactccagaccgctgcaaaagagctccatccttacgaa
gtgcctgaaatcattgcacttgaaatagcagaagggctacctgcctacctgagctggatt
gatgaatcaacccgaccgaaattctga

DBGET integrated database retrieval system