KEGG   Desulfomonile tiedjei: Desti_5623Help
Entry
Desti_5623        CDS       T02147                                 

Definition
(GenBank) 2-oxoacid:acceptor oxidoreductase, gamma subunit, pyruvate/2-ketoisovalerate family
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
dti  Desulfomonile tiedjei
Pathway
dti00010  Glycolysis / Gluconeogenesis
dti00020  Citrate cycle (TCA cycle)
dti00620  Pyruvate metabolism
dti00633  Nitrotoluene degradation
dti00640  Propanoate metabolism
dti00650  Butanoate metabolism
dti00680  Methane metabolism
dti01100  Metabolic pathways
dti01120  Microbial metabolism in diverse environments
dti01130  Biosynthesis of antibiotics
dti01200  Carbon metabolism
Module
dti_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dti00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Desti_5623
   00020 Citrate cycle (TCA cycle)
    Desti_5623
   00620 Pyruvate metabolism
    Desti_5623
   00640 Propanoate metabolism
    Desti_5623
   00650 Butanoate metabolism
    Desti_5623
  Energy metabolism
   00680 Methane metabolism
    Desti_5623
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Desti_5623
Enzymes [BR:dti01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Desti_5623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: AFM28203
UniProt: I4CF62
Position
6479245..6479793
Genome map
AA seq 182 aa AA seqDB search
MIEMRFHGRGGQGAVTCAELVAQAAIDTGRYATAFPSFGPERRGAPVIAFARVDEQPIRL
RSKIYAPDVVVVLDPSLLDIASPAVGLRDNGILIVNSPYDPETLKKHLGYQNRIAVVDAG
RIAREVLGLPITNTTMVGALVKGTGIMDVESLKAPFRKRFGKIADRNIQAMERAFNETLV
VA
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaatgagatttcacggcagaggcggccaaggcgcggttacatgtgcggaactg
gttgcccaggccgctatagacacgggcaggtatgccaccgccttccccagtttcggaccg
gaacggcgaggagcgcccgtgattgcattcgctcgggtggatgaacaacccattcgattg
agatccaaaatttatgcgccggatgtagtagtggtcctggacccgtcacttctggatatc
gccagtcccgcagtcggacttcgggataacggcattctgatcgtaaattccccctacgat
cccgaaaccctgaagaagcatctcggttatcaaaatagaatcgctgtcgtggatgcagga
cgcattgctcgagaagtgcttgggctaccaattacgaacacaacgatggtcggggctttg
gttaaaggcaccggaataatggatgttgaatccttgaaagcacctttcaggaaacgattc
ggaaaaattgccgatcgcaatatccaggctatggagagagctttcaacgaaaccctggtg
gtcgcctga

DBGET integrated database retrieval system