KEGG   Dietzia timorensis: BJL86_0673Help
Entry
BJL86_0673        CDS       T04608                                 

Definition
(GenBank) Acetyl-hydrolase
  KO
K14731  epsilon-lactone hydrolase [EC:3.1.1.83]
Organism
dtm  Dietzia timorensis
Pathway
dtm00903  Limonene and pinene degradation
dtm00930  Caprolactam degradation
dtm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BJL86_0673
  09111 Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    BJL86_0673
Enzymes [BR:dtm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.83  monoterpene epsilon-lactone hydrolase
     BJL86_0673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_3 Say1_Mug180 Thioesterase Peptidase_S9
Motif
Other DBs
NCBI-ProteinID: ANI91475
UniProt: A0A173LGV0
Position
complement(727779..728855)
Genome map
AA seq 358 aa AA seqDB search
MTGYEASSQDTGDFDLSSELDEEIRDSDVATDGSELEHPFEYRSGAHGLTYRNPPNATWR
SRIVSVSMRRVLRPALDRMPPDQRALGRLRTMTNGIGRAGALETSGNWDNTGPVPGLWVG
RHRFFTSDKLVFMLHGGGFTFGSPWSHKFLAARLARELGAPTILPDYRLAPEHQFPAAIE
DAIASYEWILGQGYSPENIIFAGDSAGGNLALQLTNHLVDAGEPTPAGVVLLSPWVDMNL
ADMTSRDMERKDPFLAIGLVEKSRDLYAPGLDPDDPRISPVNLNFSSEWPPFLIQCGGAE
IFAGGIELLHERLVASGVDSTLQVWPDQFHVFQAFHPLIPEAVGALRNVGTFMRAKTD
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaccgggtacgaagcttcttcgcaggatacgggcgatttcgacctatcctccgagctc
gacgaggagatccgagacagcgacgtggctacggatggctccgagctcgagcaccctttc
gagtaccgttccggtgctcacggactcacttatcggaatccgccgaatgccacgtggcgt
tccagaatcgtctcggtatcgatgcgccgcgtgctgcggcccgcgctcgaccggatgccc
ccggaccaacgcgcgctcggccggcttcgcacgatgaccaatgggataggccgcgccggc
gcgctcgagacctcggggaattgggacaacaccggccccgtgcccggcctctgggtcgga
cgtcaccggttcttcacctccgacaagctcgtcttcatgctccacggcggcggcttcaca
ttcggctcgccctggtcccacaagtttctcgctgcccgcctggcccgcgagctcggcgcg
cccacgatcctccccgactatcggctcgccccggaacatcagttccccgcggcgatcgag
gacgccatcgccagttacgagtggatcctcggccaggggtacagccccgagaacatcatc
ttcgcgggcgactcggcgggtggaaacctcgcactccagctcaccaatcatcttgttgac
gccggagagccgacgcccgccggcgtcgtcctgctttctccgtgggtggacatgaatctc
gcggacatgacgagccgggacatggaacgcaaggacccgttcctcgcgatcgggctggtc
gagaagtctcgggatctctatgcccccgggctcgatcccgacgacccgcgaatctcaccg
gtcaacctcaatttctcgagcgaatggccgccgtttctcatccagtgtggtggcgcggag
attttcgccggcggtatcgagctgctccacgagcggctggtcgcctccggagtcgactcg
acgctgcaggtgtggccggaccaattccacgtcttccaggcctttcacccgctcatcccg
gaggcagtgggagcgttgcggaacgtcggcaccttcatgcgtgcgaagaccgactga

DBGET integrated database retrieval system