KEGG   Dietzia timorensis: BJL86_1835Help
Entry
BJL86_1835        CDS       T04608                                 

Definition
(GenBank) putative malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
dtm  Dietzia timorensis
Pathway
dtm00020  Citrate cycle (TCA cycle)
dtm00620  Pyruvate metabolism
dtm01100  Metabolic pathways
dtm01110  Biosynthesis of secondary metabolites
dtm01120  Microbial metabolism in diverse environments
dtm01130  Biosynthesis of antibiotics
dtm01200  Carbon metabolism
Module
dtm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dtm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BJL86_1835
   00620 Pyruvate metabolism
    BJL86_1835
Enzymes [BR:dtm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     BJL86_1835
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: ANI92606
UniProt: A0A173LJV7
Position
complement(1997688..1999181)
Genome map
AA seq 497 aa AA seqDB search
MTVPQGNKQTNTDVVLIGAGVMSATLGALLRRLQPDWSIEILERLNGPSQESSDAWNNAG
TGHSALCELNYTPKTGDGGVDISKAVGVNEKFQVSRQFWSFGVENNLLGDPSEWINPVAH
MSFVRGEEGQKYLRKRFELLSKHPLFETLEHTEDIDEISKLVPLVGKDRNPDEKVALSHI
KGGTDVNFGALTRQLLGYLARTGTDVRYQAEVKNLERSTDGSWKVRYVNRALDEEHTINA
KFVFVGAGGGALHLLQKSGIPEIRGIGGFPVGGQWLRCTNEELVEQHNAKVYGQAAVGAP
PMSVPHLDTRIIDGKRALLFGPFAGWTPKFLKRGKFTDLPLSVRPNNFLSMAGVGVTELG
LVKYLVTELAKTHEKRVETLREFMPSAESGDWEKVIAGQRVQVIKPNKKTGGTLEFGTAV
VNSSDGSIAGLLGASPGASTAVDAMLDVLSRCFPDRMATWDAAIKEMVPSYGRSLSEDVT
LFNEQFERSQKALKLES
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
gtgacggtcccacagggcaataagcaaacgaatacagacgttgttctcatcggtgcaggc
gttatgagcgcgacgctcggtgctctgctgcgccgactgcagccggactggtcgatcgag
atcctcgagcggctcaacgggccttcgcaggaatcctcggacgcgtggaacaacgccggt
acgggccactcggcactgtgcgagctcaactacacccccaagaccggggacggcggtgtc
gacatctccaaggccgtcggcgtgaacgagaagttccaggtgtcgcgccagttctggtcc
ttcggcgttgagaacaacctgctcggcgatccgtccgagtggatcaaccccgtcgcccac
atgagcttcgttcgcggcgaagaggggcagaagtacctgcgtaagcgtttcgaattactg
agcaagcacccactgttcgaaacgctcgagcacaccgaggacatcgacgagatcagtaaa
ctcgtccccctcgtcggcaaggatcgcaatcccgatgagaaggtcgccctcagccacatc
aagggcggcaccgacgtgaacttcggtgccctcacccgtcagctgctcggttacctggca
cgcacgggaaccgatgtcaggtaccaggccgaggtcaagaacctcgagcgcagcactgat
ggttcgtggaaggtgcgatacgtcaatcgtgcgctcgacgaggagcacacgatcaacgcg
aagttcgtctttgtcggcgcaggcggaggtgccctgcacctgctgcagaagtccggcatc
ccggagatccgcggaatcggcggcttcccggtcggcgggcagtggctccggtgcacgaac
gaggagctcgtcgaacagcacaacgcgaaggtgtacgggcaggccgccgtgggcgctccg
ccgatgtcggtgccgcacctcgacacccgcatcatcgacggcaagcgcgccctcctcttc
ggcccgttcgccggctggaccccgaagttcctcaagcgcggcaaattcaccgacctcccg
ctgtccgtccgcccgaacaacttcctgtccatggcgggtgtaggcgttaccgagctcggc
ctggtcaagtatctcgtcaccgagctcgccaagacgcacgagaagcgcgtcgagacgctg
cgcgagttcatgccgagcgccgaatccggcgactgggagaaggtcattgccggccagcgc
gtgcaggtcatcaagccgaacaagaagaccggcggaacgctggagttcggtaccgccgtc
gtcaactcttccgatggctcgatcgcgggactcctcggtgcatccccgggcgcctcgacc
gcggtcgacgcgatgctcgacgttctgagccgctgcttccccgaccgcatggcgacgtgg
gatgccgcgatcaaggagatggttccgtcctatggccgctcgctttcggaggacgtgacc
ctgttcaatgagcagttcgagcgttcgcaaaaggcgctcaagctcgaatcgtag

DBGET integrated database retrieval system