KEGG   Dietzia timorensis: BJL86_1938Help
Entry
BJL86_1938        CDS       T04608                                 

Definition
(GenBank) putative low-affinity inorganic phosphate transporte r
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
dtm  Dietzia timorensis
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BJL86_1938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: ANI92706
UniProt: A0A173LK52
Position
complement(2100544..2101782)
Genome map
AA seq 412 aa AA seqDB search
MLVTISVLIILVLVVMTALAFDFTNGFHDTGNAMATSIATGALSPRVAVGLSAILNLVGA
FLSVEVALTVTTDVLHIQSKEASGALVAGLDSQTALLIVFAGLVGGIIWNLLTWLFGLPS
SSSHALFGGLIGAGLGATAIAGISGAVNWNGVISKVVVPALFSPVIAGVIAAIGTALVYA
ITKSVGDNFRRSGFRWGQIGTASLVSLAHGTGDAQKTMGVIALALVAAGQLNASDAAENG
LPVWIIVSCAVAIAAGTYMGGWRIIRTLGKGLVEIESPQGMAAEAASAAIIMTSSHAGMA
LSTTHVATGSILGSGVGKPGAKVRWGVAGRMLAAWVITLPLAGLVGFTAFLVAESISKAT
GDALIGGSVIFIILVALSLYIYQHSRSQTVSADSVNNDWDHENEPVTIGANK
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtgaccatttctgtcctcatcattctcgtgctcgtcgtcatgaccgcgctggca
ttcgacttcaccaacggctttcacgacaccggcaacgcgatggcgacctccatcgcgacc
ggcgctctgagccctagggtcgccgtcggtctgtctgcgattctcaatctcgtcggtgcg
ttcctatccgtcgaggttgctctcacggtgacgacagacgttcttcatatccagagcaag
gaagcatccggcgcactcgtcgccggactcgactcccaaacggctcttctcatcgtcttc
gccggtcttgtcggcggtatcatctggaacttgctcacgtggctgttcggcctgccctcc
agctcttcacacgcgctgttcggcggcctgatcggggcggggctcggagccaccgcgatc
gcgggcatctccggcgcggtcaactggaacggcgtcatctccaaggttgtcgtccccgcg
ttgttctctccggtcattgccggcgtaatcgcagcgatcggcacggccctggtgtacgcg
atcacaaagtcggtcggcgataacttccgccgcagtggcttccgctggggccaaatcggc
accgcctcgctcgtttctctcgcgcacggcaccggcgatgcgcagaagacgatgggcgtt
attgccctcgcgctcgtcgctgccggccagctcaatgcctctgacgccgcagagaacggt
ctcccggtctggatcatcgtctcctgtgccgtggcgatcgcagccggtacgtacatgggt
ggatggagaattatccgcactttgggcaaggggctcgtcgagatcgaatcccctcagggg
atggcggccgaggctgcctcggcagcgatcatcatgacgtcctcgcacgcgggcatggcg
ctgtccaccacgcacgttgctaccggctcgatcctcggctccggtgtcggcaagcccggc
gcgaaggtgcggtggggtgtggccgggcgaatgctcgcagcgtgggtcattactctgccg
cttgccggactcgtcggattcaccgcgttcctcgtcgccgaatccatctccaaggccacg
ggcgatgcgctcatcggcggaagcgtgatcttcatcattctcgtcgcgctgtcgttgtac
atctaccagcactcgcgttcgcagaccgtgtccgcggattcggtgaacaacgactgggat
cacgagaacgagcccgtcaccatcggcgcaaacaagtag

DBGET integrated database retrieval system