KEGG   Dietzia timorensis: BJL86_2231Help
Entry
BJL86_2231        CDS       T04608                                 

Definition
(GenBank) Methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
dtm  Dietzia timorensis
Pathway
dtm00450  Selenocompound metabolism
dtm00970  Aminoacyl-tRNA biosynthesis
dtm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    BJL86_2231
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BJL86_2231
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dtm01007]
    BJL86_2231
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dtm03016]
    BJL86_2231
Enzymes [BR:dtm01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     BJL86_2231
Amino acid related enzymes [BR:dtm01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   BJL86_2231
Transfer RNA biogenesis [BR:dtm03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BJL86_2231
 Prokaryotic type
   Other AARSs
    BJL86_2231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: ANI92996
UniProt: A0A173LKX5
Position
complement(2413286..2415127)
Genome map
AA seq 613 aa AA seqDB search
MGKAVFVAVAWPYANGPRHIGHVSGFGVPSDVFARFQRMSGNEVLMVSGTDEHGTPLLVQ
AEKEGVPVQALADRYNRVIVDDLVGLGLSYDLFTRTTTRNHFAVVQELFRGLHDNGYMVP
KTTTGAISPSTGRTLPDRYIEGTCPICGYSGARGDQCDNCGNQLDPIDLKDPVSKINGET
PEFVETEHWFLDLPALAEALGTWLDGRTDWRPNVLKFSKNLLADLRPRAMSRDIDWGIPI
PIPDWQDRKDKKLYVWFDAVVGYLSASIEWAWRTGEPEAWRRWWTDPEALAYYFMGKDNI
TFHSQIWPAELLGYTGQGAKGGQPGTFGELNLPTEVVSSEFLTMSGSKFSSSRGVVIYVR
DFLDTFGADALRYFIAVAGPENQDTDFTWDEFVRRVNFELANEWGNLVNRTISMAHKNFG
HIPEPAELEDLDTELLAAAEKAFDTVGEHLSQSRFKAGATEAMRVVGAANRYIAACEPWK
LAKDPEQRDRLATVLHTALQVVSDANALLTPFIPSASQKVFEALGGTGVWAAMPEAREVE
DDMPVEPVGVGVPEAGRTYATIQGNYASAKAVWARTPIEPGTELAKPSPIFAKLDPELAE
TGPEWAPVQHEDA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagctgtgttcgtcgccgtcgcatggccgtatgccaacggcccccgccacatc
ggccacgtgtccggattcggtgttccttcggacgtgttcgcgcgtttccagcgaatgtcg
ggcaacgaggtactcatggtctccggcaccgacgagcacggcaccccgcttctcgtgcag
gcggagaaggaaggcgtgccggtccaggcgctcgccgaccgctacaaccgcgtcatcgtc
gacgacctcgtcggcctcggtctgtcctacgacctgttcacccgcacgactacccggaat
cacttcgcggtggtacaggaactcttccgcgggttgcacgacaacggctacatggtcccc
aagaccacgaccggcgcgatcagcccgtcgacgggccgcacgctgccggaccggtacatc
gagggcacgtgcccgatctgcggttactccggcgcccgcggcgaccagtgcgacaactgc
gggaaccagctcgacccgattgatttgaaggacccggtgtcgaagatcaacggcgagacc
ccggaattcgtggagaccgagcactggttcctcgatctgcccgcgctcgccgaggcgctg
ggtacgtggcttgacgggcgcaccgattggcgaccgaacgtgctcaagttctccaagaac
ctgctcgccgatctgcgcccgcgcgcgatgagccgcgatatcgactggggcatcccgatc
ccgatcccggactggcaggaccgcaaggacaagaagctctacgtgtggttcgacgccgtc
gtgggctacctgtccgcgtcgatcgaatgggcgtggcggaccggcgagccggaagcgtgg
cgtcgctggtggaccgaccccgaggcgctcgcctactacttcatgggcaaggacaacatc
accttccactcgcagatctggcccgctgaactgctcgggtacaccggccagggcgccaag
ggcggccagccgggcacgttcggcgagctcaatctgcccacagaggtcgtgtcctcggag
ttcctcacgatgagcggctcgaagttctcctcctcgcgtggcgtcgtcatctacgtgcgc
gacttcctcgacaccttcggcgccgacgcgctgcggtacttcatcgccgtggccgggccg
gagaaccaggacaccgacttcacgtgggacgagttcgtgcgccgggtcaatttcgagctc
gccaatgagtggggcaatctcgtcaaccggacgatctcgatggcccacaagaacttcggc
cacatcccggaacccgccgagctcgaggacctcgacaccgagctgctcgcggccgcggaa
aaggcgttcgacaccgtcggggagcacctgtcgcagtcgcggttcaaggccggcgccacc
gaggcgatgcgcgtggtcggcgcggccaaccgctacatcgcggcgtgcgaaccgtggaag
ttggcaaaggacccggagcaacgggaccgactcgcgaccgtgctgcacaccgcgttgcag
gtggtctccgatgccaacgctctactcaccccgttcatcccgtctgcctcgcagaaggtg
ttcgaggcgctcggcggcaccggcgtgtgggcggccatgcccgaggcgcgcgaggtcgaa
gacgacatgcccgtcgagccggtcggcgtcggcgtgcccgaggcagggcgcacctacgcc
acgatccagggcaactacgcttctgcgaaggcagtgtgggcgcgcacgccgatcgagccg
ggcaccgagctcgcgaagccgagcccgattttcgccaagctcgatccggagctcgccgag
accggccccgagtgggcgcccgtccaacacgaggacgcctga

DBGET integrated database retrieval system