KEGG   Defluviitoga tunisiensis: DTL3_0762
Entry
DTL3_0762         CDS       T03867                                 

Definition
(GenBank) hypothetical protein
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
dtn  Defluviitoga tunisiensis
Pathway
dtn00472  D-Arginine and D-ornithine metabolism
dtn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    DTL3_0762
Enzymes [BR:dtn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     DTL3_0762
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: CEP78072
UniProt: A0A0C7NQ91
Position
I:802744..803130
AA seq 128 aa
MKERPDDFIERSEKLQHMTDEELNKYFWELAERVVEPLVELAQTHTSPSIERSVLLRMGF
NSLQAKALVERISQERLLSKGAGNVVYQLANLKNIDILQAGEELIKGNYWEEVENLFKGG
STDETSTK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaaagaaagaccagatgattttattgagaggtcagagaaactgcaacacatgacagat
gaagagttgaataaatacttttgggaacttgcagaaagggtggtagaacctttagtagaa
ctagctcaaacgcatacttctccctcaatagagagatctgtgctgcttagaatgggattc
aactcgttgcaagcaaaggctcttgttgaaagaatttctcaagaaagacttttgtcaaaa
ggtgcgggtaatgttgtatatcaacttgcgaatctaaaaaatattgatatcttgcaagct
ggagaagaactaataaaaggaaattattgggaagaagtagaaaatttattcaaaggtggg
agtacagatgaaacttcaaccaaatga

DBGET integrated database retrieval system