KEGG   Defluviitoga tunisiensis: DTL3_1879Help
Entry
DTL3_1879         CDS       T03867                                 

Definition
(GenBank) HAD family hydrolase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
dtn  Defluviitoga tunisiensis
Pathway
dtn00010  Glycolysis / Gluconeogenesis
dtn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dtn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DTL3_1879
Enzymes [BR:dtn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     DTL3_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: CEP79160
UniProt: A0A0C7P4A0
Position
I:complement(2049671..2050261)
Genome map
AA seq 196 aa AA seqDB search
MKNIVFDLGNVLFRFDPKEILDDLFEEELIKKKIIKDVFKTKIWADLDRGTISYNDACRI
WLNNNPDLKSELMLLLVNWHKYLTPIEENISFLYRLKSKGKNLYVLSNFHEHAFNYIRTH
YSFFELFDGMVISYQVKLLKPEKEIYNLLIENYNLIPEQTIFIDDSLENVKAAEEVGIKG
ILYLNSEELYKQLDGL
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaatatagttttcgacttaggaaatgtgctttttcgatttgatccaaaagagatt
ttggatgatttattcgaagaagagttaataaagaaaaagataattaaagatgtattcaaa
acaaaaatatgggcggatttagatagaggtacaattagttataacgatgcgtgtagaatc
tggttaaacaataatccggatttaaagagcgaacttatgttacttcttgtaaattggcac
aaatatttaacacctattgaagaaaatatatcttttctttatcgtttaaaatctaaagga
aagaatttgtatgttctttctaactttcatgaacatgccttcaattatataagaacgcat
tattctttttttgagctatttgacggaatggtgatttcatatcaggtaaaattattgaaa
ccagagaaagaaatatacaatcttttaatagaaaattataacctaattcctgagcaaact
atttttatagatgattcattagaaaatgttaaagctgctgaagaagtaggaataaaaggt
atcttgtatttgaattctgaagaattatataaacaattagatggtctataa

DBGET integrated database retrieval system