KEGG   Desulfobacula toluolica: TOL2_C02310Help
Entry
TOL2_C02310       CDS       T02268                                 

Gene name
padI1
Definition
(GenBank) PadI1: phenylglyoxylate:acceptor oxidoreductase, subunit I
Organism
dto  Desulfobacula toluolica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: CCK78401
UniProt: K0NC70
Position
280480..281439
Genome map
AA seq 319 aa AA seqDB search
MTEKKKGKLTKVLDHLKHEDPFSKGVAFCPGCGLELLIRLIPRILGNDIVITGTPSCSAP
VLLGQNNQSWHKLSYFGTLMTGAAANATGLARYYRKAGIDNTVVCFNGDGTAADIGFGNL
SGAAERNEPFIYICYDNEGYMNTGIQKSGTTPFGATTTTTPFGSASKGKNLRRMSLALKM
AMHKIPYAATATLSDLDDLAKKLLKAKEAKKRGFAFLHILAPCTTGWGFAPENTIEVCRR
AVKTNYFPLWEAENGKIRMTKTVKKPKPISNYTQLSKKFAHLNEADLQILQDDVDYEYCM
LGGLSQLEAECQLPVSAED
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaaaagaaaggcaaactgacaaaggttctggatcacctcaagcatgaggac
cctttttcaaaaggagtggcattctgccctggctgcggtcttgagttattgatacgactg
atccccagaattttgggcaatgatatcgtcattaccggtacgccatcgtgttcagcgcca
gttctgcttggacagaacaaccagtcatggcataaactgtcttattttggaaccttgatg
acaggtgctgccgccaatgccacaggtcttgccagatattacagaaaagcgggcattgat
aacacggttgtctgtttcaacggtgatggaacagccgcagatatcgggtttggaaacctg
tccggtgctgcggaaagaaacgaaccttttatttatatttgttatgacaatgaaggttac
atgaataccggtatccagaaaagcggcaccaccccctttggtgcgaccacaacaacaacg
ccgtttggatcggcttccaaagggaagaatcttagaagaatgagtcttgccctgaaaatg
gccatgcacaaaattccctatgccgccaccgccaccttaagcgacctggacgatcttgcg
aaaaaattattaaaagccaaagaagccaaaaaaagaggttttgcattccttcatattctt
gctccctgcacaaccggctggggtttcgcacctgaaaataccattgaagtgtgccgaagg
gctgtaaaaacaaattatttccccctttgggaagcagaaaatggcaaaatcaggatgacc
aaaaccgttaaaaaacccaaacctatatccaactatacccagttgagtaaaaaattcgct
catttgaatgaagcagatcttcagatccttcaggatgatgtggattacgaatactgtatg
ttgggcgggttgagccagctggaagcagaatgtcagcttccggtatctgcggaagattag

DBGET integrated database retrieval system