KEGG   Desulfobacula toluolica: TOL2_C04470Help
Entry
TOL2_C04470       CDS       T02268                                 

Gene name
aprB
Definition
(GenBank) AprB: adenylylsulfate reductase, beta subunit
  KO
K00395  adenylylsulfate reductase, subunit B [EC:1.8.99.2]
Organism
dto  Desulfobacula toluolica
Pathway
dto00920  Sulfur metabolism
dto01100  Metabolic pathways
dto01120  Microbial metabolism in diverse environments
Module
dto_M00596  Dissimilatory sulfate reduction, sulfate => H2S
Brite
KEGG Orthology (KO) [BR:dto00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    TOL2_C04470 (aprB)
Enzymes [BR:dto01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.99  With unknown physiological acceptors
    1.8.99.2  adenylyl-sulfate reductase
     TOL2_C04470 (aprB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APS-reductase_C Fer4_9 Fer4_7 Fer4 Fer4_4 Fer4_10 Fer4_16 Fer4_3 Fer4_6 Fer4_11 Fer4_2 Fer4_21 Fer4_18 Fer4_8
Motif
Other DBs
NCBI-ProteinID: CCK78616
UniProt: K0NCP7
Position
complement(539752..540189)
Genome map
AA seq 145 aa AA seqDB search
MPSFVIAEKCDGCKGGDKTACMYICPNDLMVLDPNEMKAYNQEPDQCWECFSCVKICPSQ
AIEVRGYSDFVPMGGSTVPMMGTEDVMWTCKFRNGVVKRFKFPIRTTPEGEANDYADLKG
KDLDSGLLSTQEADGYVLVAPTELA
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgccatcttttgtaattgcagaaaaatgtgacggctgcaaaggtggggacaaaacagca
tgcatgtacatctgtcccaatgacctgatggttcttgatcctaatgaaatgaaagcatat
aaccaggaacccgatcagtgctgggaatgcttttcatgtgtaaaaatctgtccttcccag
gcaatagaagtcagaggatattctgactttgtacccatgggaggttctactgttcctatg
atgggaactgaagatgttatgtggacatgtaaattcagaaacggcgttgtaaaacgcttt
aagttcccaatcagaactactcccgaaggtgaagcaaatgattatgctgaccttaaaggt
aaagatcttgacagtggacttctttctacacaggaagcagacggttatgtacttgtagct
ccaactgagctggcataa

DBGET integrated database retrieval system