KEGG   Desulfobacula toluolica: TOL2_C05520Help
Entry
TOL2_C05520       CDS       T02268                                 

Gene name
galU
Definition
(GenBank) GalU: UTP--glucose-1-phosphate uridylyltransferase (UDP-glucose pyrophosphorylase)
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dto  Desulfobacula toluolica
Pathway
dto00040  Pentose and glucuronate interconversions
dto00052  Galactose metabolism
dto00500  Starch and sucrose metabolism
dto00520  Amino sugar and nucleotide sugar metabolism
dto01100  Metabolic pathways
dto01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TOL2_C05520 (galU)
   00052 Galactose metabolism
    TOL2_C05520 (galU)
   00500 Starch and sucrose metabolism
    TOL2_C05520 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    TOL2_C05520 (galU)
Enzymes [BR:dto01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TOL2_C05520 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: CCK78720
UniProt: K0ND68
Position
complement(667676..668548)
Genome map
AA seq 290 aa AA seqDB search
MKIKKAVFPVAGLGTRFIPATKAMAKEMLTVVDKPIIQYAVEEAFEAGIEQIIFVTGRGK
KALEDHFDRSYEIEHALQEKGKDDLLKQIQELVPKTGNIIYTRQHQPLGLGHAILCAKDI
VGDEPFAVLLADDLIQTDKPVLSEMVKKFDRLRASMAAVMEVEKDQTDKYGILDAQQVEE
DIFRIDDMVEKPSPDQAPSNLAIIGRYILTPKIFEYLEKKEKGAGGEIQLTDAMKTLLKE
QPIYGYKFKGTRFDCGDKAGFQMANLSFALERPDLRDRLIKFIREIQKKY
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaaaggctgtttttccggtagcaggacttggcacgagatttatccccgca
accaaagccatggctaaagagatgctcactgttgttgacaaacccatcatccagtatgcg
gttgaagaagcctttgaagccggtatcgaacagattatttttgttacgggccgtgggaaa
aaagcacttgaagaccattttgacaggtcttatgaaatagaacacgcactacaggaaaaa
ggcaaagacgatcttttaaaacaaatccaggaacttgttcccaaaacaggcaacattatt
tatacccgtcagcaccagcctttgggcctgggtcatgccatattgtgtgcaaaagatatt
gtcggagatgagccgtttgcagtacttctggctgatgaccttatccagaccgataaaccc
gttctttccgaaatggtaaaaaaattcgaccggttacgggcatccatggctgcggtcatg
gaagtggaaaaagaccagacagacaaatacggcatccttgatgcccaacaggtggaagaa
gatattttccgaatcgacgatatggtggaaaaaccaagtccggaccaagccccttccaac
cttgccattataggccgctatatcctcacccccaaaatttttgaatatttagaaaaaaaa
gaaaaaggcgcgggaggagaaatccagcttaccgatgccatgaaaacccttctcaaagaa
cagccgatctatggatataaatttaagggaacacgctttgactgtggagataaagcagga
ttccagatggccaacctttcatttgcccttgaaagaccggacctgagagacaggctgata
aaattcatacgagaaattcaaaaaaaatattag

DBGET integrated database retrieval system