KEGG   Desulfobacula toluolica: TOL2_C05960Help
Entry
TOL2_C05960       CDS       T02268                                 

Gene name
pcm
Definition
(GenBank) Pcm: protein-L-isoaspartate O-methyltransferase (protein-beta-aspartate methyltransferase)
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
dto  Desulfobacula toluolica
Brite
Enzymes [BR:dto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TOL2_C05960 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_23 Methyltransf_25 Methyltransf_32 Methyltransf_31 Methyltransf_18 Methyltransf_11 DUF938 GCD14 MTS TehB ACP_syn_III_C DREV
Motif
Other DBs
NCBI-ProteinID: CCK78764
UniProt: K0N3R4
Position
715916..716572
Genome map
AA seq 218 aa AA seqDB search
MNDEPKKFVRWRREMVEKQIMSRGITDPLVLEAMRTVPRHLFVSEALVESAYGDFPLPIG
EGQTISQPYIIAEMTQSLKLKGHERVLEIGTGSGYQAAILAKIVYKVYTIERNNTLFLQT
RKLFDRLKYYNIVTRYSDGTQGWKQESPFDAIIVTAGGQQIPAPLIEQLAIGGRLIMPVG
SNFLQELLHLEKTEDGIKTTNLGACRFVRLIGQHGWDE
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgaacctaaaaaatttgtccgctggcgtcgtgaaatggttgaaaaacagatt
atgtcacggggaataacagatccattggttcttgaggcaatgagaacagtgccaaggcat
ttgtttgtcagtgaagcccttgtcgaaagcgcatatggggatttcccgcttcccattgga
gaggggcagacaatttctcaaccctatattattgctgagatgactcagagtctcaagtta
aaaggccatgaaagagttcttgagatcggtacaggatcagggtatcaggctgccatcctg
gctaagatcgtctataaggtgtataccattgaaagaaacaataccttgtttttgcaaaca
agaaagctttttgacaggttgaaatactataatattgttaccagatatagcgacggaacc
cagggttggaaacaggaaagtccgtttgatgctattattgttactgccgggggccagcag
attcctgcaccgctgattgaacagcttgcaatcggggggcgtcttattatgccggtgggc
agtaattttttacaggaactgctacatcttgaaaagacagaagacggaataaaaacaaca
aaccttggtgcttgcagatttgtaagattgattggtcagcatggctgggatgagtag

DBGET integrated database retrieval system