KEGG   Desulfobacula toluolica: TOL2_C11420Help
Entry
TOL2_C11420       CDS       T02268                                 

Definition
(GenBank) thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dto  Desulfobacula toluolica
Pathway
dto00071  Fatty acid degradation
dto00072  Synthesis and degradation of ketone bodies
dto00280  Valine, leucine and isoleucine degradation
dto00310  Lysine degradation
dto00362  Benzoate degradation
dto00380  Tryptophan metabolism
dto00620  Pyruvate metabolism
dto00630  Glyoxylate and dicarboxylate metabolism
dto00640  Propanoate metabolism
dto00650  Butanoate metabolism
dto00900  Terpenoid backbone biosynthesis
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
dto01212  Fatty acid metabolism
dto02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TOL2_C11420
   00630 Glyoxylate and dicarboxylate metabolism
    TOL2_C11420
   00640 Propanoate metabolism
    TOL2_C11420
   00650 Butanoate metabolism
    TOL2_C11420
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TOL2_C11420
   00072 Synthesis and degradation of ketone bodies
    TOL2_C11420
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TOL2_C11420
   00310 Lysine degradation
    TOL2_C11420
   00380 Tryptophan metabolism
    TOL2_C11420
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TOL2_C11420
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TOL2_C11420
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TOL2_C11420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dto04147]
    TOL2_C11420
Enzymes [BR:dto01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TOL2_C11420
Exosome [BR:dto04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TOL2_C11420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_C Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCK79306
UniProt: K0NE83
Position
1344063..1345229
Genome map
AA seq 388 aa AA seqDB search
MGKVGVIGVGQSSFVRGYPGSIKELAFEGFSDALKDANIKTTDIAASVVCSSPEYDKQRS
AAGVMAEYLGLTPQPTFYVETLCSSSSTGVKVAYSLIESGLHDVVAVVGFQKMSEITSAE
SQERMGRGADIQWESPFGTMMPAYYAMYAQGHMAKYGTTPDDLALIRVKSSTYGQINDRA
VYRKPVTFEMFKDPKSPMSNPVASPLRVGDCCANADGSSCIILANEEKTKQFAKKPVWIR
GIGAASTTVNLAGRDVFSGLTAGEMAGAEAYKMAGITPQHIDVAEVHDCFTIAEMMAYEN
LGFAKPGEGKDLIKSKETYKEGSIPVNVDGGLLSKGHPIGATGGSQIRTIVLQLRGEAGE
MQVKDPEFGLVHNIGGVGLYGNVTIFGR
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtaggagttattggagtaggccaaagttcctttgttcgaggctaccctggt
tcgatcaaagaactggcttttgaaggtttcagtgacgctttaaaggatgcgaatattaaa
acaacagatatagctgcttctgttgtctgttcttctccggaatatgataaacaacgttca
gctgcaggcgtaatggcagaatatctgggtctgacccctcagccaacattttatgtggaa
actctttgttcttcaagcagcacgggcgtaaaagttgcttattctctcattgaatccggt
cttcatgatgttgttgcagttgttggtttccagaagatgtcggaaatcacatcagccgaa
tcacaggaaagaatgggacgtggagctgatattcagtgggaaagcccgtttgggacaatg
atgcccgcttattatgccatgtatgcccagggacatatggcaaaatatggtactacgcct
gatgatctggcacttatcagagttaaatcatctacatatggacaaattaatgaccgggca
gtatatcgcaagcccgtaacatttgaaatgttcaaagatcccaaaagccccatgtcaaat
ccagttgcaagccctcttcgggtaggagattgttgtgcaaacgctgacggcagctcatgt
attatcctggcaaatgaggaaaaaacaaagcagttcgctaaaaaacctgtatggatcagg
ggtatcggtgctgcatccactacggtaaatcttgccggaagagacgttttttcaggcctt
acagccggtgaaatggcaggtgccgaagcatacaaaatggcaggtatcacacctcagcat
attgatgttgcagaagttcatgactgttttaccattgcagagatgatggcctatgaaaat
cttggttttgcaaaacctggagagggaaaagacctgatcaagagcaaggaaacctacaaa
gagggaagcatccctgttaacgtagacggcggactgctctcaaaaggacatcccatcgga
gccacaggcggatcacaaataagaactatagttcttcagctgagaggcgaagcaggcgaa
atgcaggtaaaagatcctgaattcggattggtccataacattggtggcgtaggcctgtat
ggtaatgtcaccatttttgggaggtaa

DBGET integrated database retrieval system