KEGG   Desulfobacula toluolica: TOL2_C11790Help
Entry
TOL2_C11790       CDS       T02268                                 

Gene name
metH
Definition
(GenBank) MetH: 5-methyltetrahydrofolate corrinoid/iron-sulfur protein methyltransferase
  KO
K15023  5-methyltetrahydrofolate corrinoid/iron sulfur protein methyltransferase [EC:2.1.1.258]
Organism
dto  Desulfobacula toluolica
Pathway
dto01100  Metabolic pathways
dto01120  Microbial metabolism in diverse environments
dto01200  Carbon metabolism
Module
dto_M00377  Reductive acetyl-CoA pathway (Wood-Ljungdahl pathway)
Brite
Enzymes [BR:dto01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.258  5-methyltetrahydrofolate:corrinoid/iron-sulfur protein Co-methyltransferase
     TOL2_C11790 (metH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind CdhD
Motif
Other DBs
NCBI-ProteinID: CCK79342
UniProt: K0NKT0
Position
complement(1390756..1391661)
Genome map
AA seq 301 aa AA seqDB search
MILFGESLNVISRVIGKEFKEADPAKRNPVPIQEEVLRQKELGMDYIDINLGPAKKFGTE
LMPWVVNVVQEAVPGMPLLLDSSNIDAIEAGLKVCKPADQPHIINSIMARPERYEKMVPL
AAQYDADFVALMWGPEGLPRDENERAALAVELIYFANEAGVANERIWVDGIVTPVNIQQQ
QLMSLMNFQMMLEEIAPGAKSTCGLSNISNGPPEHLRGILNQTYMVMLEKYGMKSVISDP
LDKQLTAIAKGQRQDIVDLIYGMMDGNEPDIAGLDKELQDYAKTYKVIMGETLYSDSWLE
I
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgatactatttggtgaaagtctgaatgtcatttccagagttattggaaaagaattcaaa
gaagcagatcccgccaaacgtaatccagtacccattcaggaagaagttttaagacaaaaa
gaactgggaatggattatattgatatcaacctggggcctgcaaaaaaattcggcaccgaa
ttaatgccatgggttgtcaatgttgttcaggaagctgttccgggaatgccccttcttctt
gactcatcaaacattgatgccattgaagcaggacttaaagtttgtaaacctgctgatcag
ccgcatatcatcaattctattatggcacgtcctgaaagatatgaaaaaatggttcccctg
gctgctcaatacgatgctgattttgttgcactgatgtggggtccggaaggtcttccaaga
gatgaaaatgaaagagccgcccttgccgttgaattgatttattttgccaacgaagcgggc
gttgcaaatgaacggatctgggttgacggtattgtaaccccagtcaatatccagcagcag
cagttgatgagtctgatgaatttccagatgatgcttgaagagattgcaccgggtgctaag
tctacctgcggtctttccaatatctccaatggacctccggaacatcttcgcggcattctc
aatcagacctacatggttatgcttgaaaaatacggtatgaaatccgtcatttctgatccc
cttgacaaacaattgactgctattgccaaaggccagcgtcaggatatcgttgacctgatt
tacggcatgatggatggcaatgaacctgatattgcaggcctggataaagaactgcaggat
tatgcaaaaacctataaagtcattatgggcgaaacactctattctgattcatggcttgaa
atttag

DBGET integrated database retrieval system