KEGG   Desulfobacula toluolica: TOL2_C21500Help
Entry
TOL2_C21500       CDS       T02268                                 

Definition
(GenBank) 2-dehydro-3-deoxyglucarate aldolase
  KO
K01630  2-dehydro-3-deoxyglucarate aldolase [EC:4.1.2.20]
Organism
dto  Desulfobacula toluolica
Pathway
dto00053  Ascorbate and aldarate metabolism
dto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dto00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    TOL2_C21500
Enzymes [BR:dto01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.20  2-dehydro-3-deoxyglucarate aldolase
     TOL2_C21500
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpcH_HpaI PK
Motif
Other DBs
NCBI-ProteinID: CCK80311
UniProt: K0NGG6
Position
complement(2507299..2508051)
Genome map
AA seq 250 aa AA seqDB search
MNKVKYKLNNGLYSIGTWLQLSNVSVAEIIGNAGYDWVAMDLEHGFFSPDMIGLICLALE
KGGTIPFARVAQVNPKDIKQALDAGVKGLVLPMIKTAKDLQNGISWAKYPPYGSRGVGYS
RANLFGRKFDKTVPESSKDLTIIAQIEHITAVQNLDEILEVKGLDGIMVGPYDLSASMGI
TAEFDNPDFISVMDKIKIKAENSGVPMGSHIVQPDPEVLCKKIQEGYKFIAYGIDAVFLY
NAVECPVVTG
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagttaaatacaaattaaataacggtttatattcaatcggaacatggcttcaa
ttgtcgaatgtttctgttgctgaaattataggaaatgcaggatacgactgggttgctatg
gatttggagcatggttttttctcacctgatatgataggtttgatttgtcttgctctggaa
aagggcggtacaataccttttgccagggtcgcacaggtaaatccaaaagatattaagcag
gcccttgatgccggggtcaaaggtcttgttttacctatgatcaagactgcaaaagatttg
caaaatggaatctcatgggctaaataccccccctacggatctcgcggtgtcggatattcc
agagctaatcttttcggccggaaatttgataaaaccgtacctgagagttcaaaggatttg
acaataattgctcagatagaacatattacagcagttcaaaatctggatgaaattttagag
gtgaaaggccttgatggaattatggttggaccgtatgatttgtcggcatcaatgggtatt
acagcagaatttgataatcctgattttatatcggtaatggataaaattaaaataaaagct
gaaaattcaggggttcctatgggttcacatatagttcaacctgatcctgaagtactctgt
aaaaaaattcaggaagggtataaatttattgcatacggaattgatgctgttttcctctat
aacgcggtggaatgcccggttgtgacagggtga

DBGET integrated database retrieval system