KEGG   Desulfobacula toluolica: TOL2_C27600Help
Entry
TOL2_C27600       CDS       T02268                                 

Gene name
ubiX5
Definition
(GenBank) UbiX5: 3-octaprenyl-4-hydroxybenzoate carboxylyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
dto  Desulfobacula toluolica
Pathway
dto00130  Ubiquinone and other terpenoid-quinone biosynthesis
dto00627  Aminobenzoate degradation
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dto00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    TOL2_C27600 (ubiX5)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TOL2_C27600 (ubiX5)
Enzymes [BR:dto01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     TOL2_C27600 (ubiX5)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein PaO CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: CCK80920
UniProt: K0NLG5
Position
complement(3245824..3246444)
Genome map
AA seq 206 aa AA seqDB search
MKKRIVIGLAGASGIIYGVKMLEYLREMDYETHLIISEAGKLNIRIETDYKPEDVAAMAD
FTYDHKNVAAAPASGSFLTEGMVVVPCTVKTLSGIANSYTENLLVRAADVSLKEKRKLVL
VVRETPLHKGHLRLMSQAADVGAHILPPVPSFYHMPKTIDDIIDQTIGKVFDYMGIQHNL
FKRWGENSSRGKIPSRHPQKPVVIGV
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaagaattgttataggtcttgcaggggcaagtggtattatttatggtgtaaaa
atgcttgaatatctgagagaaatggattacgaaactcatctgatcatttctgaagctgga
aaactcaatatccggattgaaacagattacaaacccgaagatgtagcagccatggcagat
tttacatatgaccacaagaatgtagctgctgcaccagcgagcggttcttttttgaccgaa
ggcatggtggtggtgccttgcacggtaaaaacgctctccggaattgccaattcctatact
gaaaatcttctggttagagcagcggatgtttctcttaaagaaaagcggaaacttgttttg
gtggttcgagaaactccactacataaggggcatttgagattgatgagccaagcggctgat
gtaggtgcccacattcttccccctgtcccatcattttatcacatgcccaaaactattgat
gatatcattgatcaaaccattggaaaggtttttgattacatgggcatccaacataatctt
ttcaaacgctggggagaaaacagcagccggggtaaaattcccagtcgccatcctcaaaaa
ccggttgttataggagtctga

DBGET integrated database retrieval system