KEGG   Desulfobacula toluolica: TOL2_C28470Help
Entry
TOL2_C28470       CDS       T02268                                 

Gene name
sucC2
Definition
(GenBank) SucC2: succinyl-CoA ligase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
dto  Desulfobacula toluolica
Pathway
dto00020  Citrate cycle (TCA cycle)
dto00640  Propanoate metabolism
dto00660  C5-Branched dibasic acid metabolism
dto01100  Metabolic pathways
dto01110  Biosynthesis of secondary metabolites
dto01120  Microbial metabolism in diverse environments
dto01130  Biosynthesis of antibiotics
dto01200  Carbon metabolism
Module
dto_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dto_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dto00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TOL2_C28470 (sucC2)
   00640 Propanoate metabolism
    TOL2_C28470 (sucC2)
   00660 C5-Branched dibasic acid metabolism
    TOL2_C28470 (sucC2)
Enzymes [BR:dto01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     TOL2_C28470 (sucC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 Ligase_CoA GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: CCK81007
UniProt: K0NQ58
Position
3345155..3346288
Genome map
AA seq 377 aa AA seqDB search
MRLHEYEGAEIFEKFGIPVPRRGVVRTVEGALNMADEIGYPVVLKSQVLVGGRGLAGGIK
IADSSDELEIMTDELLNMEIKGCRVKEIMISEKANIAKELYMAITIDGYSGKPIVVVSTE
GGVHIEKTAKESSDKIASAIIDPKFGFYPYQAQKLLRQLNLSPKPLTACSDILVRLYKVF
EKYEAIIAEINPLVILKNGGIVAVDAVLEIDDSAMFRLKKSLSLPSENRAGNSLENKGKE
IGVTYVDLEGDIGLISSGAGLGMASMDIIGNKLKPSNFLETGGGITADLLYKCMELIMMK
DLKAIFINIYGGINPIHEGAKGIVKYIKEHNLTIPIVAKALGNHQEETWEILKSGGVHVV
TEAATETAVDKLIALLK
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgagattacacgagtatgaaggcgcggaaatttttgaaaaatttggcataccggttcca
agaagaggagtcgtaagaactgttgaaggcgccttaaacatggcggatgagattgggtat
ccggttgttcttaaatcacaggtacttgttggcggacgcgggcttgccgggggaatcaag
attgccgactcatcggatgaacttgaaataatgacggacgagcttttgaatatggaaata
aaaggctgtcgtgtcaaagagataatgatcagtgaaaaagcaaatattgcaaaagaactc
tacatggccatcacgattgacgggtattcaggaaaacccattgttgttgtcagcactgaa
ggcggtgtccatattgaaaaaaccgcaaaagaatcatccgacaagatcgcctcggcaata
atagatccaaaatttggattttacccttaccaggcacaaaaacttttaaggcagcttaat
ctgtccccaaaacctttaacagcctgttccgacatcctggtgcgtctttacaaggtgttt
gaaaaatacgaggccataatagctgaaatcaatccccttgtcattttaaaaaacggtgga
attgtggcggttgacgcggttcttgaaattgatgactctgccatgttcagactcaaaaaa
tccctttcattgcccagtgaaaaccgagcgggaaattcccttgaaaacaagggaaaagaa
attggggttacctatgttgatcttgaaggagatattggattgatttcgtccggtgcaggt
ctgggcatggcatcaatggatattatcggcaacaaattaaaaccttcaaacttccttgaa
acaggcggcggtataacagcagatcttctctataaatgcatggagttgatcatgatgaaa
gatttgaaagccatcttcataaacatatatggcggcatcaatcccattcatgaaggggct
aaagggattgtaaaatacatcaaagaacataatctgaccattcctattgttgcaaaggct
cttggaaatcaccaggaggaaacatgggaaattttaaaatccggtggtgtccatgttgta
accgaagcagcgactgaaactgcagttgacaagctgattgcccttctaaagtaa

DBGET integrated database retrieval system