KEGG   Desulfobacula toluolica: TOL2_C36430Help
Entry
TOL2_C36430       CDS       T02268                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
dto  Desulfobacula toluolica
Brite
KEGG Orthology (KO) [BR:dto00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    TOL2_C36430
Enzymes [BR:dto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     TOL2_C36430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-ProteinID: CCK81800
UniProt: K0NM83
Position
complement(4264398..4265306)
Genome map
AA seq 302 aa AA seqDB search
MDQKIFADLHNHTTASDGDFTPDQIIEQAKRLGIRVIGITDHDTLKGLKTATAAGKKNGI
DVIPGVEVSIRFKRSYFTGTLHLLCYFSPAMLMEDSFMAKINKILAKGRGDKLVRARVDE
INKFFGPNGTTPLLNRDLKFEDIAELSDNATRRHFSLALKDGFGIIDADTINAIIGNDSP
AYLPSGIKLEQAVDIIREQGILAVLAHPAAGSFPGKGHYKEVLPPLDIVQQILPEFIEAG
VRGLEVYYPGHIKAHQDLMKSWAEKYHLLVTGGSDCHDGIERPLGVQGLCEKEYVVFKAA
LA
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggatcagaaaatatttgctgatttgcacaatcacacaacggcatctgatggagatttc
acacccgatcagattattgaacaggcaaaacgtcttggtataagggtcattggtatcact
gaccatgatacgctaaaggggttgaaaaccgcaacggctgcaggaaaaaagaacggtatt
gatgtgattccgggagtggaagtttctattcggtttaagcgttcttattttaccgggaca
ttgcaccttttgtgttatttttcaccggccatgcttatggaagattctttcatggcaaaa
attaataaaattttagccaaaggaaggggagataaactggtaagggcaagggttgacgaa
attaataaatttttcggaccgaacgggaccacccctttgttaaacagggatctgaaattt
gaagatatcgctgaattaagtgataatgccacaagacgccatttttcccttgcgttaaag
gacgggtttggcattattgatgccgataccatcaatgccatcattggaaatgacagtcct
gcataccttccttccggaataaaactggaacaggcagtggacatcatccgggaacagggt
atccttgctgttttggcccatccggcagcaggttcttttcccggcaaggggcattataag
gaagtgctgccgcccctggacattgttcagcagatactgccggagtttattgaagcaggg
gttcgcgggctggaagtttattatcccggccatattaaagcccatcaggacctgatgaaa
tcctgggcagaaaaatatcatcttttggtgaccggcggatcggattgtcatgatggaata
gagcgtcctttaggggtgcaaggactatgtgaaaaggaatatgtcgtgtttaaggctgct
ttggcataa

DBGET integrated database retrieval system