KEGG   Desulfobacula toluolica: TOL2_C41900Help
Entry
TOL2_C41900       CDS       T02268                                 

Gene name
recC
Definition
(GenBank) RecC: exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
dto  Desulfobacula toluolica
Pathway
dto03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:dto00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    TOL2_C41900 (recC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:dto03400]
    TOL2_C41900 (recC)
Enzymes [BR:dto01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     TOL2_C41900 (recC)
DNA repair and recombination proteins [BR:dto03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     TOL2_C41900 (recC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C Imm61
Motif
Other DBs
NCBI-ProteinID: CCK82346
UniProt: K0NL93
Position
complement(4957166..4960672)
Genome map
AA seq 1168 aa AA seqDB search
MENHKINSVQEIVPGLSIIHSNHLEDLRKVAAGWIKAHPLKVLETEQFIVQSNGMAQWLK
LALADDDGCGISAGLEVHLPGRYVWTAYRSVLGNDSIPVDSPYDRDRLVWRFFRLLPLLS
EEEAFLPLNRFLEHDEDQRKQYQLACHLADLYDQYQVYRADWLEDWSKGKDRLKTGRGEP
VELPLEHKWQAQLWRRLKNDIPTQFQEIGRADLHQRFLRQIAQMDHRPDTLPPRVMVFGI
SSLPQQVLETLHAVSRLCQVLLFVHNPCRHFWADIIEDRDLLRIEHARHRSKDSMPDPLD
PELLHQHANPLLAAWGKQGRDYIGLLYGYDEPDTYQQQFAQIDLFDDFIAQGTNGSLLQQ
VQQAILDLVPLPGEKEDKQQVTEDDLSISFQLAHSRQREVEILQDQLLHCFETIECLNPR
DVIVMTPDIEAYAPHIEAVFGNLAFHDSRFIPFTIADKPGRESVPLLKALEKLLHLPDSR
MAVSDIMDLLEVPAFRNRFGVKEADLPKLHQWIKGAGISWGLNPDQRTGFGLPPGLEQNT
WEFGLKRMLLGYAVGKAQEWNGIEPYDEVGGLEAALIGPLAAVIEQMESLWKILSRPGSP
EQWCLRIRSLAKNCFLPEESRDRLILNRLDEVLDNWLDACTQAELDRELTLAVVRDFFLG
MIIQSSISQRFLAGMVNFGTLMPMRAIPFKVVCLLGMNDKEFPRSHPPLDFDLMAQKGLY
RPGDRSRREDDRYLFLEALLSAREKFYISYVGRDVRDNSPRMPSVLVGQLRDYISAGWSL
EDCGDDDNEKNTLIDQLTCIHPLQPFGSAYFLKTQPRLFTYAHEWRSSLEVKESGIIEDS
LEKTLFDEILNLGSLIRFVKNPVKYFFNQSLSIYFDQIRVVSQDQEPFVLDALAPFGLGN
QLLEAGLSADPAQMQTAVLKEAERLTRTGELPMAGFGLLAAQQLSEPVMLMLKHHQTLLS
KWPLKCDPMEISIPLDPERSLLTALDDWLDRLYQTDSPDALPRFGRWEFYPKSILDKKGN
VLRIYCLIPLWIRHVSGCAQGINLASFLVAPDGIASLDPLEPAKAMEILMTLIEQFWTGL
TRPLAVTARTGIAYVDALMTKDAQTAKSKALKTYEGDGFQSQGELGYDPYLQRAFPDFDA
LWQARDNSFERLCQTLYKPLVNAVRKEA
NT seq 3507 nt NT seq  +upstreamnt  +downstreamnt
atggagaaccacaagatcaacagcgtacaagaaattgtccccggcctttccattatccat
tccaaccacctggaagacttgagaaaagtggctgcaggctggatcaaggcccatcccctg
aaggtgctggaaaccgagcagttcatcgttcagagcaacggcatggcccagtggctcaag
cttgccctggctgatgacgacgggtgcggtatcagtgccgggcttgaagttcatctgccc
ggacgctacgtctggaccgcctatcgttccgtactgggaaatgacagtatccccgtggac
tctccctatgacagggatcggctggtttggcggtttttcaggctcttgcccctgctgtcg
gaggaggaggcgtttctacccctgaaccggttccttgaacacgatgaggaccagcgcaag
caataccagctggcctgtcacctggcagacctctatgatcagtatcaggtctaccgggcc
gactggttagaagactggtcaaaaggcaaagatcggctcaaaaccggcaggggtgaaccc
gttgaattgcccctggaacacaaatggcaggcccaattgtggcgcaggctgaaaaacgat
attccaacacaatttcaggagatcggtcgtgcagaccttcaccagcggtttctcaggcag
attgcccaaatggatcaccggcccgataccctgccgccccgggtaatggtatttgggatc
tcatcgttgccccaacaggtgctggaaaccctgcatgccgtgtcccgcctttgccaggtg
ctgctgtttgtacacaatccctgccgccacttctgggcagatatcattgaagaccgtgac
ctgttgcgcatcgaacatgcccgtcatcgcagcaaggattccatgccggaccctcttgat
ccggaactgctgcaccagcacgccaacccgctgcttgcggcatggggcaaacagggcagg
gattacatcggccttctttacggatatgacgagcctgatacctatcaacagcagtttgcc
cagatagacctgtttgatgattttattgcgcagggcacaaacggcagtctgctgcaacag
gttcagcaggcgatcctcgaccttgttcctttgcccggtgaaaaagaagacaaacaacag
gtgacagaagatgatctgtccataagtttccagctggcccacagccgccagcgggaggtg
gagatccttcaggaccagcttcttcattgttttgaaaccattgaatgcttaaatcccagg
gatgtcattgtgatgactccggatatcgaggcctatgcacctcatatcgaagctgtgttc
ggcaaccttgcgtttcatgattcacggtttattccctttaccattgcagacaaacccggc
agggaaagcgttcctttgctcaaggcccttgaaaaacttctgcacctgcccgattcgcgc
atggctgtcagcgacatcatggacctgctggaagttccggcctttcgaaacaggttcggt
gttaaagaagccgacctgccaaagcttcaccaatggatcaagggcgcaggcataagctgg
ggattgaacccggatcagcgcaccggttttgggctgccgcccggtcttgaacagaatacc
tgggagtttggcctgaaaagaatgctgctgggctatgccgtgggtaaggcccaggaatgg
aacggtattgaaccctatgatgaagtgggggggcttgaagccgccctgatcggccccctg
gcagccgtgatcgagcagatggaaagcctatggaaaatattgagcaggccggggtctcct
gaacaatggtgtttgcgaatccgatctcttgcaaaaaactgttttctgcctgaagaaagc
cgggaccggctgattctcaaccgcctggacgaggtgctggacaactggctcgacgcctgt
acccaggccgaacttgacagggagctgacccttgccgttgtacgggatttttttcttgga
atgataatacaatccagtatatcccagcggtttcttgccgggatggtcaatttcggcacc
ctcatgcccatgcgtgccattccctttaaggtggtgtgccttttgggaatgaacgacaaa
gaatttccaaggagccatccgccgcttgatttcgaccttatggcccaaaaaggtctttat
cgaccgggagacaggtccaggcgggaggatgaccgctatctttttctggaagccctgctc
tcggcccgggaaaaattttatatcagttatgtgggaagagatgtccgggataacagcccc
cgcatgccgtcggttctggtgggccagcttcgtgactatataagcgcaggctggagcctt
gaagattgtggggatgacgacaatgaaaaaaacacacttatagatcagcttacctgtatt
catccccttcagccttttggcagtgcatattttctcaaaacgcaacccaggctttttacc
tatgcccatgagtggcgaagttcccttgaagttaaggaatccgggatcattgaagattcc
ctggagaagaccttgtttgatgaaattcttaaccttggttcgctgatcaggtttgtgaaa
aatcccgtgaaatattttttcaaccagagcctttccatatactttgatcaaatccgtgtt
gtcagtcaagaccaggagccctttgtccttgacgcccttgcacctttcgggcttggcaac
cagcttctggaagcagggctttcagcagatcctgcacagatgcaaaccgctgttttaaaa
gaagccgagcgtctgacccgcacaggagaactgcccatggcgggattcggcctgctggct
gcacaacagctttcagaaccggttatgctaatgctcaagcaccaccagaccctcttgtcc
aagtggccgctaaagtgtgaccccatggaaatatcgattccccttgatcctgaacggtct
ttgttaactgctctggacgactggctggatcggctttatcaaacagattccccggacgct
ttgccacgtttcgggcggtgggaattttatcccaaatccattctggacaaaaagggaaat
gttttgcggatttactgcctgattcccctctggatacggcatgtttcaggctgcgcccag
ggcataaatcttgccagtttccttgttgccccggacgggattgcaagccttgatcccctt
gagcctgcaaaagccatggaaattctcatgacccttattgaacagttttggacagggctt
actcgcccgcttgccgtgacggccaggacgggaattgcctatgttgacgctctgatgaca
aaagatgctcaaacagcaaagagcaaggcattaaaaacttatgaaggagacggcttccaa
tcacaaggagagcttggctatgatccttaccttcaacgagcctttcctgattttgacgca
ctgtggcaggcccgggacaacagctttgaacggctttgtcaaactctttataaacctttg
gtcaatgccgttagaaaggaggcatga

DBGET integrated database retrieval system