KEGG   Candidatus Desulfovibrio trichonymphae: RSDT_0020Help
Entry
RSDT_0020         CDS       T05578                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
dtr  Candidatus Desulfovibrio trichonymphae
Pathway
dtr00471  D-Glutamine and D-glutamate metabolism
dtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    RSDT_0020 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:dtr01011]
    RSDT_0020 (murI)
Enzymes [BR:dtr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     RSDT_0020 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:dtr01011]
 Precursor biosynthesis
  Racemase
   RSDT_0020 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race FIST
Motif
Other DBs
NCBI-ProteinID: BAV91532
UniProt: A0A1J1DUS0
Position
complement(28085..28927)
Genome map
AA seq 280 aa AA seqDB search
MHNPSLLPVALFDSGMGGLTVLKALAECLPAEDMIYLGDTARLPYGTKGCDTIIRYTLKA
AGKLVDMGVKMLVVACNTATATALPTIRDHFAPLPVLGVVEPGAMAAAGASRNGQIVVIA
TEATIAGGAYQQAIARIRPEARVLGQACTLFVPLAEEGWMKGAIVEGIARHYLKHVFTPA
VTTAVTTPRPDTLLLGCTHFPLLLHALQRVVGPHVRIIDSAATTAQCVKEELTRRALLRN
AGHTGVSRFLTTDNCARFARTGSLFLGRPLKPDEVDLIDL
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgcataacccttccctgctgcctgtcgccctgtttgactcgggcatgggcggtttgact
gtgcttaaggctctggcagaatgtttgccggccgaggatatgatctacttgggggataca
gcccgtctgccttacggcaccaaggggtgtgacaccatcattcggtataccctcaaggcg
gcgggcaaactggtggatatgggcgttaaaatgctggttgtagcctgcaataccgcgaca
gcgaccgcactgcccacaattcgcgaccattttgccccgctgccggtgctgggtgttgtg
gagccgggcgccatggccgccgccggcgcgagccgcaacggacagattgtggttatcgcc
acagaagccactattgccggaggcgcctatcaacaggctattgcacgtattcgtccggaa
gcgcgcgtgctggggcaggcctgcacgctgtttgtccccctcgccgaagagggctggatg
aagggagccattgtcgagggcatcgcccgacactatttgaagcacgtttttacaccggcc
gttacgacggccgttacgaccccgaggccggacacgctgttgttgggctgcacgcatttt
cccctgctgctgcacgccctgcagcgcgttgtagggccgcatgtgcgcatcattgactca
gcggccacaacagcgcagtgcgtaaaggaagaactgaccaggcgcgctttgctgcgaaac
gccggccataccggcgtcagccgttttttgacaacagataattgcgcccgttttgcccgc
accggaagtttgtttctgggacgtcccttgaagccggatgaggtagatcttattgatttg
taa

DBGET integrated database retrieval system