KEGG   Delftia tsuruhatensis: BI380_02445Help
Entry
BI380_02445       CDS       T04496                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K17760  quinohemoprotein ethanol dehydrogenase [EC:1.1.9.1]
Organism
dts  Delftia tsuruhatensis
Brite
KEGG Orthology (KO) [BR:dts00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BI380_02445
Enzymes [BR:dts01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.9  With a copper protein as acceptor
    1.1.9.1  alcohol dehydrogenase (azurin)
     BI380_02445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PQQ PQQ_2 PQQ_3 Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-ProteinID: AOV00296
UniProt: A0A1D8IV73
Position
complement(519770..521893)
Genome map
AA seq 707 aa AA seqDB search
MKTHVLSSTLLAAGLALALPGATLAQAGLPSKGSPEHIRAVTSRIDSQSIRDNARSSKDW
PSYGMDYSETRFSKLRQLDTANVKRLGLVWSYDLESTRGVESTPVVVDGIMYVTASWSVV
HAVDVRTGKRLWSYDPGVDRANGFKGCCDVVNRGVAVYKGKVYVGAFDGRLVALDAATGQ
KVWEQDTIIDRAYSYTITGAPRVIKGKVLIGNGGAEYGVRGYVTAYDAETGAQQWRWFTV
PGDPSKPFENEAMARAAKTWDPAGKWWEAGGGGTAWDTMAYDPELNLMYIGTGNGSPWAQ
AKRSPAGGDNLYLASIVALNPDTGEYVWHYQETPGDSWDFTSTQPMVLADIKIGGKPRKV
ILHAPKNGFFFVIDRTNGQFISAKNFVDVNWASGYDAKGRPIETPIARSGDRARDVIPSP
FGAHNWHSMSYSPDTGLAYLPAQHVPLTLQDNKNWKFNGGSLPEPHSNIGWNTATLVNME
PPKSTPFGRLIAWDPVAQKERWRVEHASPWNGGTLATAGNLVFQGTADGRFVAYDARNGK
KLWEKPTGTGVVAAPITYEVDGRQYVSIAVGWGGVYGLAARHTERKGPGTVYTFALDGKA
EAPAFVAYQQGKLLQGVPYDKSLVAEGTALYVSNCAFCHGVPGVDRGGNLPNLGYLDPAY
IEHLDKFIFKGPAMSRGMPDFTGKLSMEDVEKIKAFIQGTADAVRPK
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccacgtgctttcctccacgctgctggccgccggcctggcgctggcccttccc
ggcgccacgctggcacaggccggcctgccaagcaaaggctcgcccgagcacatacgcgcc
gtcacctcgcgcatcgactcgcagagcatccgcgacaacgcacgcagctccaaggactgg
cccagctacggcatggactacagcgagacgcgcttttccaaactcaggcagctggacacg
gccaacgtgaagcggctgggcctggtctggtcgtatgacctggaatccacgcgcggcgtg
gagtccacgcccgtggtggtcgatggaatcatgtacgtcacggccagctggagcgtggtg
catgcggtggacgtgcgcaccggcaagcgcctgtggagctacgaccccggcgtggaccgt
gccaatggcttcaagggctgctgcgacgtggtcaaccggggcgtggcggtctacaagggc
aaggtgtatgtgggcgccttcgatggccgcctggtggcgctggacgcggccacgggccag
aaggtctgggagcaggacaccatcatcgaccgcgcctactcgtacaccatcacgggcgcg
ccgcgcgtcatcaagggcaaggtgctgatcggcaacggcggcgccgagtacggggtgcgc
ggctatgtcacggcctatgacgccgagaccggtgcccagcaatggcgctggttcaccgtg
ccaggcgatccgtccaagcccttcgagaacgaggccatggcccgcgccgccaagacctgg
gacccggccggcaagtggtgggaggccggtggcggcggcacggcctgggacaccatggcc
tatgaccccgagctcaacctcatgtacatcggcacgggcaacggctcgccctgggcgcaa
gccaagcgcagcccggccggtggcgacaacctgtacctggccagcatcgtggcgctgaac
cccgatacgggcgagtacgtctggcattaccaggagacgccgggcgacagctgggacttc
acctccacccagcccatggtgctggccgacatcaagatcggcggcaagccgcgcaaggtc
atcctgcatgcgcccaagaacggcttcttcttcgtgatcgaccgcaccaacggccagttc
atctcggccaagaacttcgtcgacgtgaactgggccagcggctacgacgccaagggccgc
cccatcgagacaccgattgcgcgcagcggcgaccgcgcccgcgacgtgattcccagcccc
ttcggcgcgcacaactggcattccatgtcctacagccccgacacgggcctggcctacctg
ccggcccagcatgtgcctctgaccctgcaggacaacaagaactggaagttcaacggcggc
tccctgcccgagccgcacagcaatatcggctggaatacggccacgctggtcaacatggag
ccgcccaagagcacgcccttcggccgcctgatcgcctgggacccggtggcacagaaggag
cgctggcgcgtggagcatgcctcgccctggaacggcggcaccctggccacggcgggcaac
ctggtgttccagggcacggccgacggccgcttcgtggcctatgacgcgcgcaacggcaag
aagctctgggaaaagcccacgggcacgggcgtggtggccgcacccatcacctatgaggtc
gatggccggcagtacgtctccatcgccgtgggctggggcggcgtctacggcctggccgcg
cgccacaccgagcgcaagggcccgggcacggtctacaccttcgcgctggacggcaaggcc
gaggcgcctgccttcgtcgcctaccagcagggcaagctgctgcagggcgtgccctacgac
aagagcctggtggccgaaggcacggccctgtacgtcagcaactgcgccttctgccacggc
gtgcccggcgtggaccgggggggcaacctgcccaacctgggctacctggacccggcctat
atcgagcacctggacaagttcatcttcaagggcccggccatgtcgcgcggcatgccggac
ttcacgggcaagctgagcatggaagacgtggaaaagatcaaggccttcatccagggcacg
gccgacgcggtgcggcccaagtaa

DBGET integrated database retrieval system