KEGG   Delftia tsuruhatensis: BI380_07040Help
Entry
BI380_07040       CDS       T04496                                 

Definition
(GenBank) calcium-binding protein
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00053  Ascorbate and aldarate metabolism
dts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    BI380_07040
Enzymes [BR:dts01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     BI380_07040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL PD40 Str_synth
Motif
Other DBs
NCBI-ProteinID: AOV01132
UniProt: A0A1D8IXC4
Position
1529393..1530271
Genome map
AA seq 292 aa AA seqDB search
MQIDIVADLKTTLGEGPLWDVGQQRLYWIDSFDGRIFRCTADGRELRAWEVGQKIGSMAL
RRDGRSALVALHGGVHTLDLESGELELVVAPEPHLPGNRLNDGKVDRQGRFVFGSMDTLE
EQPSARLYRLDTDLSLHVLDKGIICSNGPCWSPDGTTLYFSDTWSGEIRAYDYDTATGHA
SGRRTFAPVDTSGGGAADGATVDAEGCLWQALVYAGQLVRYTPDGRVDRMIEMPVRKVTS
VMFGGPGLDTLYVTSMGKPPLPRFPGDGQSRGALFAVKGLGVRGLPEQRFGA
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcagatcgatatcgtcgccgacctcaagaccacgctgggcgaaggcccgctgtgggac
gtcgggcagcagcgcctgtactggatagacagcttcgacggccgcatcttccgctgcacg
gccgacgggcgggaactgcgcgcctgggaagtcggccagaagattggctccatggcactg
cgccgcgacggccgctcggccctggtggcgctgcacggcggcgtgcacacgctggacctg
gaaagcggcgagctggagctggtcgtcgcccccgagccccaccttcccggcaaccggctc
aacgacggcaaggtggaccggcagggccgcttcgtcttcggctccatggacaccctggag
gagcagccttcggcacggctgtaccggctggacacggacctgagcctgcatgtgctggac
aagggcatcatctgctcgaacggcccgtgctggagcccggacggcacgacgctctatttc
tcggacacgtggagcggcgagatccgcgcctacgactacgacacggccacgggccatgcc
agcggccgccggacctttgccccggtcgacaccagcggtggcggcgcggccgacggggcc
acggtcgatgccgaaggctgcctgtggcaggccctggtgtacgcaggccagctggtgcgc
tacacgccggacggccgggtggaccggatgatagagatgccggtgcgcaaggtgaccagc
gtgatgttcggcgggcccgggctcgacacgctgtacgtcacctccatgggcaagccgccg
ttgccgcgtttcccgggcgacggccagtcccgtggcgcgctgtttgccgtcaaggggctg
ggcgtgcgtggcctgcccgagcagcgcttcggcgcctga

DBGET integrated database retrieval system