KEGG   Delftia tsuruhatensis: BI380_09380Help
Entry
BI380_09380       CDS       T04496                                 

Definition
(GenBank) two-component system response regulator OmpR
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
dts  Delftia tsuruhatensis
Pathway
dts02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dts00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BI380_09380
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:dts02022]
    BI380_09380
Two-component system [BR:dts02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   BI380_09380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ DUF43
Motif
Other DBs
NCBI-ProteinID: AOV05863
UniProt: A0A1D8JAX3
Position
2074653..2075384
Genome map
AA seq 243 aa AA seqDB search
MATTTNRTDKILVVDDDARIRDLLRRYLTQEGFEIMIAEDGKALNRILLRETVDLIVLDL
MMPGEDGLSICRRLRSANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARI
HAVLRRRPPQEAPGAPSGDNEVVSFGPFTFDLGTRVLQKNGEELPLTTGEFAMLKALVRH
PRQPLSREKLALLARGREFEPFDRSLDVQVSRLRKLIEEDAAAPRYIQTVWGVGYVFVPD
GAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atggccactacgaccaaccgcaccgacaagatcctggtggtggatgacgatgcgcgcatc
cgcgacctgctgcgccgctacctgacgcaggaaggcttcgagatcatgattgccgaagat
ggcaaggcgctgaaccgcatcctgctgcgcgaaacggtggacctgatcgtgcttgacctg
atgatgcccggcgaagatggcctgtccatctgccgccgcctgcgctcggccaacgaccgc
acgcccatcatcatgctgaccgccaagggcgaggatgtggaccgcatcgtgggcctggaa
gtgggcgccgacgactacctgggcaagcccttcaacccgcgcgaactgctggcccgcatc
catgccgtgctgcgccgccgcccgccgcaggaagcgccgggcgcgccttccggcgacaac
gaggtggtgagcttcggccccttcaccttcgacctgggcacgcgcgtgctgcaaaagaac
ggcgaggaactgccgctgaccacgggcgaattcgccatgctcaaggccctggtgcgccac
ccgcgccagccgctgtcgcgcgagaagctggccctgctggcgcgcggccgcgaattcgag
cccttcgaccgcagcctggacgtgcaggtctcgcgcctgcgcaagctgatcgaggaagat
gccgccgcaccgcgctatatccagacggtctggggcgtcggctatgtgttcgtaccggac
ggcgcgaactga

DBGET integrated database retrieval system