KEGG   Delftia tsuruhatensis: BI380_11880Help
Entry
BI380_11880       CDS       T04496                                 

Definition
(GenBank) pseudouridine synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
dts  Delftia tsuruhatensis
Brite
KEGG Orthology (KO) [BR:dts00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dts03016]
    BI380_11880
Enzymes [BR:dts01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     BI380_11880
Transfer RNA biogenesis [BR:dts03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    BI380_11880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AOV01993
UniProt: A0A1D8IZV4
Position
2557797..2558699
Genome map
AA seq 300 aa AA seqDB search
MVDSSAYTHALMSQPSSPIAQPLPSECGDAPLHILWRDEHLVAVYKPAGWLVHRTGLDAH
ETRFVLQTLRDQLGCHVHPAHRLDKGTCGVLVMTLHAQAAQRLGQAFAGQQVRKQYLALV
RGWLPDAVEVDHALRPDDAPEDAPAQPARTALRCLARLEWPEAFDPRHAATRISLVQALP
ATGRRHQIRRHLKHVAHPIIGDATHGKGPLNRWWAERLGLQRLWLHAHALELAHPMTGEP
LSFEADWSRLGHVPDVQQWRALCALPGWQACAGLPATAGLDQAASAGAPVSGCSISGAAT
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
gtggtggacagcagcgcctacactcacgccctcatgtcccagccctcatcccccatcgcc
cagccgctgccctcggagtgcggcgacgcaccgctgcacatcctctggcgcgacgagcac
ctggtggcggtctacaagcccgcaggctggctggtgcaccgcacgggactggacgcgcac
gagacgcgcttcgtgctgcagaccctgcgcgaccagctgggctgccatgtgcaccctgcg
caccggctggacaagggcacctgcggcgtgctggtgatgaccctgcatgcccaggccgcg
cagcggctgggccaggcgtttgccgggcagcaagtgcgcaagcaatacctggcgctggtg
cgcggctggctgcccgatgcggtggaggtggaccacgcgctccgacccgacgatgcgccc
gaggacgcgccagcccagcccgcacggactgcgctgcgctgcctggcccggctcgaatgg
cccgaggcctttgatccgcgccatgcggccacgcggatttcgctggtccaggcgctgcct
gccacgggccgccgccaccagatacgccgccatctcaagcatgtggcccatcccatcatt
ggcgacgccacgcacggcaaggggccgctgaaccgctggtgggccgagcgcctgggcctg
cagcggctgtggctgcatgcccatgcgctggagctggcgcacccgatgacgggcgagccg
ctgagcttcgaggccgactggagccggctgggccatgtgcccgatgtgcagcaatggcgc
gcgctgtgcgccctgcccggctggcaggcctgtgcgggcctgccggcgacggccgggctg
gatcaggcagcttcggcaggcgcgcccgtttcaggctgctccatcagcggcgcggccacg
tag

DBGET integrated database retrieval system