KEGG   Delftia tsuruhatensis: BI380_12590Help
Entry
BI380_12590       CDS       T04496                                 

Definition
(GenBank) molybdopterin adenylyltransferase
  KO
K03831  molybdopterin adenylyltransferase [EC:2.7.7.75]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00790  Folate biosynthesis
dts01100  Metabolic pathways
dts04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BI380_12590
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    BI380_12590
Enzymes [BR:dts01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.75  molybdopterin adenylyltransferase
     BI380_12590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MoCF_biosynth
Motif
Other DBs
NCBI-ProteinID: AOV02114
UniProt: A0A1D8J050
Position
2725495..2726100
Genome map
AA seq 201 aa AA seqDB search
MSEPVHDAVRIGIVSISDRASSGVYEDKGLPALQDWLTRALRNPITFEPRLIPDEQAGIS
AALIELVDAGCCLVLTTGGTGPAPRDVTPEATLAVADKEMPGFGEQMRQISLAFVPTAIL
SRQVAVIRGKSLIINLPGQPKAIAETLEGLKNPDGTQKVNGIFAAVPYCVDLIGGPYLET
DDSVCKAFRPKNAVRAPRTAD
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaacccgtccatgacgccgtgcgcatcggcatcgtttcgatcagcgaccgtgcc
agcagcggcgtctatgaggacaagggcctgccggccctgcaggactggctcacccgcgcg
ctcaggaaccccatcacgttcgagccgcgcctgatccccgacgagcaggccggcatcagc
gccgcgctgatcgagctggtcgatgccggctgctgcctggtgctgaccacgggcggcacc
ggccccgccccgcgcgatgtcacgcccgaagccacgctggccgtggccgacaaggaaatg
ccgggctttggcgagcagatgcgccagatcagcctggcctttgtgcccacggcgatcctg
tcgcgccaggtggcggtgatccgtggcaagagcctgatcatcaacctgccgggccagccc
aaggccattgccgaaaccctggaaggtctgaagaaccccgatggcacgcaaaaggtcaac
ggcatctttgcggccgtgccctattgcgttgacctgatcggcgggccctatctggaaacg
gacgacagcgtctgcaaggcgttccgccccaagaatgccgtgcgcgcgccgcgcactgct
gactga

DBGET integrated database retrieval system