KEGG   Delftia tsuruhatensis: BI380_12635Help
Entry
BI380_12635       CDS       T04496                                 

Definition
(GenBank) fuconate dehydratase
  KO
K18334  L-fuconate dehydratase [EC:4.2.1.68]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00051  Fructose and mannose metabolism
dts01100  Metabolic pathways
dts01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    BI380_12635
Enzymes [BR:dts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.68  L-fuconate dehydratase
     BI380_12635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N MAAL_C
Motif
Other DBs
NCBI-ProteinID: AOV02121
UniProt: A0A1D8J083
Position
complement(2735789..2737066)
Genome map
AA seq 425 aa AA seqDB search
MTRILSLRVLDVRFPTSRHLDGSDAMNPDPDYSAAYVILETDTPGLEGHGLTFTIGRGNE
VCCAAIAAMRHLVEGMELDWVRQDMGRFWRHITSDSQLRWIGPDKGAMHLATGAVVNAVW
DLWAKAEGKPLWRLVADFTPEEFVRALDFRYMTDALTEAQALELLHRQSPRKAECIGVLE
REGYPCYTTSAGWLGYDDDKLRRLCREAVAGGFNHVKLKVGRSLQDDIRRVSIAREVLGP
DRQLMIDANQAWEVGQAIGWVRQLAFARPWFIEEPTSPDDVEGHRAVREAVAPIQVASGE
MCQNRILFKQFILRGAIDVVQIDACRLGGVNEVLLVLLLAAKYGLPVCPHAGGVGLCEYV
QHLSMIDFVCVSGTREGRVIEYVDHLHEHFVDPCVVRNAAYMPPGAPGFSITMKPESLAR
YRFQA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaatcctgtccctgcgcgtgctcgatgtgcgctttccgacctccaggcacctg
gatgggtctgacgccatgaacccggacccggactactccgccgcctatgtgatcctggag
acggacacgcccggccttgaggggcacgggctgaccttcaccatcgggcgcggcaacgag
gtctgctgcgctgccatcgcggccatgcgccacctggtggagggcatggagctcgactgg
gtccgccaggacatgggacgcttttggcgccacatcacctccgacagccagttgcgctgg
atcggcccggacaagggggcgatgcacctggccaccggcgccgtggtcaatgccgtgtgg
gacctgtgggccaaggccgagggcaagccgctgtggcgtcttgtggccgatttcacgccc
gaggagttcgtccgcgcgctggacttccgctacatgacggatgccctgaccgaagcccag
gcgctggagctgctgcatcgccagtcgccgcgcaaggccgagtgcatcggcgtgctggag
cgcgagggctatccctgctacacgacttcggccggctggctgggctatgacgacgacaag
ctgcgccgcctgtgccgcgaggcggtggccggcggcttcaaccacgtcaagctcaaggtg
gggcgcagcctgcaggacgatatccggcgcgtgtccatcgcgcgcgaggtgctggggccg
gatcgccagttgatgatcgacgccaaccaggcctgggaggtggggcaggccatcggctgg
gtgcggcagttggcctttgccaggccctggttcatcgaggagccgaccagccctgacgat
gtggagggccaccgcgcggtgcgcgaagccgtcgccccgatccaggtcgcctctggagag
atgtgccagaaccgcattctcttcaagcagttcatcctgcgtggcgccatcgacgtggtg
cagatcgacgcctgccggctgggaggggtcaacgaggtgctgctggtactcctgctggcc
gcaaagtacggtctgcccgtgtgtccgcatgccgggggcgtgggcctttgcgagtatgtg
cagcatctgtccatgatcgatttcgtctgcgtgtccggcacgcgtgaggggcgcgtgatc
gagtacgtggaccatctgcacgagcacttcgtggatccctgcgtggtgcgcaatgcggcc
tatatgcctcccggtgcgcccggcttttccatcacgatgaagccggaatctctggccagg
tatcgcttccaggcctga

DBGET integrated database retrieval system