KEGG   Delftia tsuruhatensis: BI380_14480Help
Entry
BI380_14480       CDS       T04496                                 

Definition
(GenBank) amidase
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00970  Aminoacyl-tRNA biosynthesis
dts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dts00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BI380_14480
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dts03029]
    BI380_14480
Enzymes [BR:dts01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BI380_14480
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BI380_14480
Mitochondrial biogenesis [BR:dts03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BI380_14480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOV02459
UniProt: A0A1D8J144
Position
3104489..3105925
Genome map
AA seq 478 aa AA seqDB search
MKNSGLRTAPASACELHAAYAAGTLTPTQATEHCLQAACESPSVFTRITAERALEEARQS
TQRWRTGRPLGPLDGVPISWKDLFDVRGTPTTAASALLRSAPPAPADAPVVARAAAAGMV
CLGKTNLSEFAYSGLGLNPGFGTPANPRLGGRARAPGGSSSGAALAVVQGCGPLAMGTDT
AGSVRIPAAFNGLVGFRASRGRYPMQGVFALSPSLDTLGPLALGVADCMALDQVLRSTVP
AGDAAAGPAVPGPVIGLQGQVFVIDPGMLDDDSVQAQVRDAIAAGLALLQRQGARVQRRR
LQSLDTVQTLTQRHGWLGAREALATHRERLDAPEQAARMDPRVRSRLEAARHLDHGGYLQ
LLARRQPLMELFAQELGGATLVLPTVGHPAPLLQPLLEDDALFAQTNLATLRLTMPGSFL
DAPAVALPCGALCLQGPGASTERLPIGLQLMRPQGDDDRLLRIALAVEQALSSLNRSQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacagcggcctccggacagcgcctgcctcggcttgcgaactgcatgcagcctat
gccgccggcacgctgacgcccacgcaagccaccgagcattgcctgcaagcggcctgtgaa
agcccgtccgtgttcacgcgcatcacggcggagcgcgcgctggaagaggccaggcaatcc
acgcagcgctggcgtacgggccgcccgctcgggccgctggacggcgtgcccatcagctgg
aaggacctgttcgatgtgcgtggcacgcccaccacggcggcatcggccctgcttcgctct
gccccgccagcccctgccgatgcccccgtggtggcgcgggccgcggcggccggcatggtc
tgcctgggcaagaccaacctcagcgagttcgcctattcgggactgggcctgaaccccggc
ttcggcacccccgccaatccccgcctgggtgggcgcgcacgggcgcctggcggctcctcc
agcggcgcggccctggccgtggtgcagggctgcgggccgctggccatgggaacggacacg
gcaggttcggtgcgcattcccgcagccttcaacgggctggtgggctttcgtgccagccgg
gggcgctatcccatgcaaggcgtctttgcgctgtcaccttccctggacacgctggggccg
ctggccctgggcgtggccgactgcatggccctggaccaggtgctgcgcagcaccgtgcct
gccggcgatgccgctgcaggccctgccgtcccaggccctgtcataggcctgcagggacag
gtgttcgtcatcgaccccggcatgctggacgacgacagcgtgcaggcgcaggtgcgcgac
gcgattgcagccggcctggccctgctgcagcggcagggcgcccgcgtgcagcggcgccgg
ctgcaaagcctggacacggtgcagacgctgacgcagcgccatggctggctgggcgcgcgt
gaggcattggccacgcaccgcgagcgcctggatgccccggagcaggccgcgcgcatggac
ccgcgcgtgcgcagccggctggaggccgcaaggcatctggaccatggcggctacctgcaa
ctgctggcacggcgccagccattgatggagctgtttgcgcaggagctgggcggcgccacc
ttggtgctgcccacggtgggccatccggcgccgctgctgcagcccctgctggaagacgac
gcgctgtttgcccagaccaatctcgccacgctgcgcctgaccatgcccggcagcttcctg
gatgcgccggccgtggccctgccctgcggcgccctgtgcctgcaaggccctggcgcgagc
accgaacggcttcccatcggcctgcagctgatgcgcccgcagggcgatgacgaccggctg
ctgcgcattgccctggccgtcgaacaggcgctttcctccctcaaccgttcccagtga

DBGET integrated database retrieval system