KEGG   Delftia tsuruhatensis: BI380_20330Help
Entry
BI380_20330       CDS       T04496                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00020  Citrate cycle (TCA cycle)
dts00640  Propanoate metabolism
dts00660  C5-Branched dibasic acid metabolism
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01120  Microbial metabolism in diverse environments
dts01130  Biosynthesis of antibiotics
dts01200  Carbon metabolism
Module
dts_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dts_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BI380_20330
   00640 Propanoate metabolism
    BI380_20330
   00660 C5-Branched dibasic acid metabolism
    BI380_20330
Enzymes [BR:dts01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BI380_20330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig
Motif
Other DBs
NCBI-ProteinID: AOV03527
UniProt: A0A1D8J499
Position
4376373..4377266
Genome map
AA seq 297 aa AA seqDB search
MSIYINKDTKVITQGITGKTGQFHTEKCIEYANGKNCFVAGVNPKKAGEKIFDVPIYASV
KEAAQGTGATVSVIYVPPAGAAAAIWEAVEADLDLAICITEGIPVRDMLEVRNKMRAKEA
AGGKRTLLLGPNCPGLITPDEIKIGIMPGHIHKKGRVGVVSRSGTLTYEAVAQLTELGIG
QSSAVGIGGDPINGLKHIDVMKAFNDDPDTDAVIMIGEIGGPDEAEAARWCKDNMKKPIV
GFIAGVTAPPGKRMGHAGALISGGADTADAKLAIMEECGFVITRNPSEMGRLLKGLI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctacatcaataaagacaccaaggtcatcacccaaggcatcacgggcaagacg
ggccagttccacacggaaaaatgcatcgagtacgcgaacggcaagaactgcttcgtggcc
ggtgtgaaccccaagaaggccggcgaaaagatcttcgacgtgccaatctacgcctccgtc
aaggaagccgcacaaggcacgggcgccacggtctccgtgatctacgttccccccgcaggc
gctgccgccgcgatctgggaagccgtggaagccgacctggacctggccatctgcatcacc
gaaggcatccccgtccgtgacatgctggaagtgcgcaacaagatgcgcgccaaggaagct
gcaggcggcaagcgcaccctgctgctgggccccaactgccccggcctgatcacgcccgac
gagatcaagatcggcatcatgcccggccacatccacaagaagggccgcgtcggcgtggtc
agccgctccggcacgctgacctacgaagccgtggctcagctgaccgaactgggcattggc
cagtcgtcggccgtgggcatcggcggtgacccgatcaacggcctcaagcacatcgacgtg
atgaaggccttcaacgacgatcccgacaccgacgccgtcatcatgatcggcgaaatcggc
ggtcccgacgaagccgaagctgcccgctggtgcaaggacaacatgaagaagccgatcgtc
ggcttcatcgcgggtgtcaccgcccctcccggcaagcgcatgggccacgccggcgcgctg
atctccggcggtgccgacacggccgacgccaagctggccatcatggaagagtgcggtttc
gtcatcacccgcaatccctccgaaatgggccgcctgctcaagggcctgatctaa

DBGET integrated database retrieval system