KEGG   Delftia tsuruhatensis: BI380_25790Help
Entry
BI380_25790       CDS       T04496                                 

Definition
(GenBank) Fe/S-dependent 2-methylisocitrate dehydratase AcnD
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00640  Propanoate metabolism
dts01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BI380_25790
Enzymes [BR:dts01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     BI380_25790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AOV04497
UniProt: A0A1D8J738
Position
5617336..5619963
Genome map
AA seq 875 aa AA seqDB search
MNNDHKKPLPGTTVHYIDARAAVDALSPGAWERLPYTARVHAENLVRRADPAQLDGYLLQ
LIERRRDIDFPWYPVRVVCHDILGQTALVDLAGLRDAIAAEGGDPAQVNPVVPVQLIVDH
SLAVECGGFDPDAFVKNRAIEDRRNEDRFHFIEWTKKAFANVDVIPAGNGIMHQINLEKM
SPVVTVQDGLAFPDTCVGTDSHTPHVDALGVIAVGVGGLEAENVMLGRASWMRMPEIVGV
RLTGRRQGGITATDIVLALTEFLRQQKVVGAYVEFFGEGADSLSIGDRATISNMCPEYGA
TAAMFSIDDQTLAYLRLTGRDEAQVRLVEAYARTAGFWSDSLADAQYERVLQFDLSTVVR
NMAGPSNPHRRLPTSALAERGIADAAKLQAARAQEAQGLMPDGAVIIAAITSCTNTSNPR
NVIAAALLARNANRLGLARKPWVKSSLAPGSKAVELYLKEAGLLTELEQLGFGIVAFACT
TCNGMSGALDPRIQQEIVERDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYALAG
TIRFDIEQDVLGVVDGREIRLKDLWPADEEIDAIVAQAVRPEQFRAVYEPMFAIRKDDGD
RARPQYDWRPQSTYIRRPPYWDTEGVGALAAFPRTLRNMRPLALLPDNITTDHLSPSNAI
LADSAAGEYLARMGLPEEDFNSYATHRGDHLTAMRATFANPQLVNEMAVIDGVQHKGSLA
RIEPEGRVVRMWEAMETYLNRRQPLIIIAGADYGQGSSRDWAAKGVRLAGVEAVVAEGFE
RIHRTNLIGMGVLPLQFLPGTDRKTLALDGTEVYGVEGERTPGTQLTLVIERRGGQTLRV
PVTCRLDTAEEVSVYEAGGVLQRFAQDFLAQAQAA
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacgaccacaagaaacccctgcccggcaccacggtgcactacatcgacgcccgc
gccgccgtcgatgcgctctcgcccggcgcctgggaacgcctgccctacaccgcccgcgtc
cacgccgagaacctcgtgcgccgcgccgatcccgcacagctggacggctacctgctgcag
ctcatcgagcgccggcgcgacatcgactttccctggtaccccgtgcgcgtggtctgccac
gacatcctgggccagaccgccctggtggacctggccggcctgcgcgacgccatcgcggcc
gaaggcggcgacccggcccaggtcaaccccgtcgtgcccgtgcagctcatcgtggaccac
tcgctggccgtggagtgcggcggcttcgatcccgatgccttcgtgaagaaccgggccatc
gaggaccgccgcaacgaggaccgcttccacttcatcgagtggacaaagaaggccttcgcc
aacgtggatgtgatccctgcagggaacgggatcatgcaccagatcaatctggagaagatg
tcccccgtggtgacagtgcaggatggcctggccttcccggatacctgtgtcggcaccgac
tcgcacacgccccatgtcgatgccctgggcgtgatcgccgtgggcgtgggcggccttgag
gccgagaacgtcatgctgggccgcgcctcctggatgcgcatgcccgagatcgtgggcgtg
cgcctcacgggccggcgccagggcggcatcaccgccaccgacatcgtgctggccctgacc
gaattcctgcgccagcaaaaggtggtgggcgcctatgtggaattctttggcgagggcgcc
gacagcctgagcatcggcgaccgcgccaccatctccaacatgtgccccgaatacggcgcc
acggcggccatgttctccattgacgaccagaccctggcctacctgcgcctgaccggccgc
gacgaggcccaggtgcgcctggtcgaggcctatgcgcgcaccgcaggtttctggagcgac
agcctggccgatgcccagtacgagcgcgtgctgcagttcgacctgtccaccgtggtgcgc
aacatggccggcccctcgaatccgcaccggcgcctgcccacctcggccctggccgagcgc
ggcattgccgatgcggccaagctgcaggccgcccgcgcccaggaggcgcaaggcctgatg
cccgatggggccgtcatcatcgcggccatcaccagctgcaccaacaccagcaacccgcgc
aatgtcatcgccgccgccttgctggcgcgcaatgccaaccgcctgggcctggcgcgcaag
ccctgggtcaaatcctcgctggcgccgggctccaaggccgtggagctgtacctgaaggag
gccggcctgctcaccgagctggagcaactgggctttggcatcgtcgcctttgcctgcacc
acctgcaacggcatgagcggcgcgctggaccccaggatccagcaggaaatcgtcgagcgc
gacctctacgccacggccgtgctctcgggcaaccgcaacttcgacgggcgcatccatccg
tatgccaaacaggccttcctggcctcgccgccgctggtcgtggcctatgcgctggcgggc
accatccgcttcgatatcgagcaggacgtgctgggcgtggtggacggccgcgagatccgc
ctcaaggacctgtggcccgccgacgaggagatcgacgccatcgttgcccaggccgtgcgc
cccgagcaattccgcgccgtctacgaacccatgttcgccatccgcaaggacgatggagac
cgggcccggccacagtacgactggcgcccccagtccacctacatccgccgcccgccctac
tgggataccgaaggcgtgggcgcgctggcggccttcccgcgcacgctgcgcaacatgcgg
ccgctggcgctgctgcccgacaacatcaccaccgaccacctgtcgccctccaacgccatc
ctggccgacagcgcggcgggcgaatacctggcgcgcatgggcctgcccgaggaagacttc
aactcctacgccacccaccgcggcgatcacctgacggccatgcgcgccaccttcgccaac
ccgcagctggtcaacgaaatggccgtcatcgatggcgtgcagcacaagggctcgctggcg
cgcatcgagcccgaaggccgcgtggtgcgcatgtgggaggccatggaaacctacctgaac
cgccgccagccgctgatcatcatcgcgggcgccgactacggccagggcagctcgcgcgac
tgggcggccaagggagtgcggctggccggagtcgaggccgtggtggccgaaggcttcgag
cgcatccaccgcaccaacctcatcggcatgggcgtgctgccgctgcagttcctgccgggc
accgaccgcaagaccctggccctggacggcacggaggtctatggcgtggaaggcgagcgc
acgccgggcacccaactcacgctggtgattgaacgcagaggcggccagacgctgcgcgtg
cccgtgacctgccggctggacacggccgaggaggtatcggtgtacgaagcgggcggggtg
ctgcagcggtttgcgcaggacttcctggcgcaggctcaggcagcctga

DBGET integrated database retrieval system