KEGG   Delftia tsuruhatensis: BI380_30465Help
Entry
BI380_30465       CDS       T04496                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dts  Delftia tsuruhatensis
Pathway
dts00071  Fatty acid degradation
dts00072  Synthesis and degradation of ketone bodies
dts00280  Valine, leucine and isoleucine degradation
dts00310  Lysine degradation
dts00362  Benzoate degradation
dts00380  Tryptophan metabolism
dts00620  Pyruvate metabolism
dts00630  Glyoxylate and dicarboxylate metabolism
dts00640  Propanoate metabolism
dts00650  Butanoate metabolism
dts00900  Terpenoid backbone biosynthesis
dts01100  Metabolic pathways
dts01110  Biosynthesis of secondary metabolites
dts01120  Microbial metabolism in diverse environments
dts01130  Biosynthesis of antibiotics
dts01200  Carbon metabolism
dts01212  Fatty acid metabolism
dts02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dts00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BI380_30465
   00630 Glyoxylate and dicarboxylate metabolism
    BI380_30465
   00640 Propanoate metabolism
    BI380_30465
   00650 Butanoate metabolism
    BI380_30465
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BI380_30465
   00072 Synthesis and degradation of ketone bodies
    BI380_30465
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BI380_30465
   00310 Lysine degradation
    BI380_30465
   00380 Tryptophan metabolism
    BI380_30465
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BI380_30465
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BI380_30465
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BI380_30465
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dts04147]
    BI380_30465
Enzymes [BR:dts01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BI380_30465
Exosome [BR:dts04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BI380_30465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2336
Motif
Other DBs
NCBI-ProteinID: AOV05347
UniProt: A0A1D8J9K1
Position
6679099..6680277
Genome map
AA seq 392 aa AA seqDB search
MNDAVIVSTARTGLAKAWKGAFNMTYGATLGGHAVEHAVARSGLDPALIEDCIMGMAFPE
GTMGGNIARAIALRAGLPVTTAGLTINRQCSSGLQAIALAAQRVLTEGAPAIVAGGCESV
SCVQNELNLHMRRDPWLVEHKPTIYWSMLQTAENVAQRYGVSKAAQDDYGVRSQVRAAAA
QAAGLFDAEIVPMTTTMGVTDKATGRITMREVTIAADEGIRPDTTLEAVQKIRAATPGGV
VTAGNASQFSDGASACVVINGKLAEQQGIAPLGIYRGFAVAGCEPDEMGIGPVFAVPRLL
QRAGLKVDDIGLWELNEAFACQVLYCRDKLGIPDERLNVNGGAIAVGHPYGVSGARMVGH
ALIEGKRRGVKYVVVTMCIGSGQGAAGLFEVC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacgctgtcattgtttccaccgcacgcaccggcctggccaaagcctggaagggc
gctttcaacatgacctacggcgccacgctgggcggccacgcggtcgaacacgccgtggcc
cgctcgggcctggacccggccctgatcgaggactgcatcatgggtatggccttccccgaa
ggcaccatgggcggcaacatcgcgcgcgccatcgccttgcgcgccggcctcccggtcacc
acggccggtctgaccatcaaccgccagtgttccagcggcctgcaggccatcgcgctggcc
gcgcaacgggtgctcaccgaaggggcgcccgccatcgtggccggtggctgcgaaagcgtg
tcgtgtgtgcagaacgaactcaacctgcacatgcgccgcgacccctggctggtggagcac
aagcccaccatctactggagcatgctgcagacggccgaaaacgtggcccagcgctacggc
gtgagcaaggcagcgcaggacgactacggcgtgcgcagccaggtgcgagccgcggccgcg
caggcggcgggtctgttcgacgccgagatcgtgcccatgaccaccaccatgggcgtcaca
gataaggccaccggccgcatcaccatgcgcgaggtgacgattgccgcagacgaaggcata
cgccccgacaccaccctggaggcggtgcaaaaaatccgcgcggccacacccggtggtgtg
gtcacggccggcaacgccagccagttcagcgacggtgcctcggcctgcgtggtgattaac
ggcaagctggcagaacagcagggcatcgcaccgctgggcatttaccgggggtttgccgtg
gccggctgcgagcccgacgaaatgggcatcggcccggtgtttgccgtgccccgtctgctg
cagcgcgccggcctcaaggtcgatgacatcggcctgtgggaactcaacgaagcctttgcc
tgccaggtgctgtattgccgcgacaagctgggcattcccgacgagcgcctcaacgtcaac
ggcggcgccatcgcggtgggccatccctatggcgtgagcggtgcccgcatggtgggccac
gccctcatcgagggcaaacgccggggcgtcaagtacgtggtcgtgaccatgtgcattggc
agcggccagggcgccgccggcctgttcgaggtctgctga

DBGET integrated database retrieval system