KEGG   Dictyoglomus turgidum: Dtur_0261Help
Entry
Dtur_0261         CDS       T00800                                 

Definition
(RefSeq) pyruvate ferredoxin/flavodoxin oxidoreductase subunit delta
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00010  Glycolysis / Gluconeogenesis
dtu00020  Citrate cycle (TCA cycle)
dtu00620  Pyruvate metabolism
dtu00640  Propanoate metabolism
dtu00650  Butanoate metabolism
dtu00680  Methane metabolism
dtu01100  Metabolic pathways
dtu01120  Microbial metabolism in diverse environments
dtu01130  Biosynthesis of antibiotics
dtu01200  Carbon metabolism
Module
dtu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0261
   00020 Citrate cycle (TCA cycle)
    Dtur_0261
   00620 Pyruvate metabolism
    Dtur_0261
   00640 Propanoate metabolism
    Dtur_0261
   00650 Butanoate metabolism
    Dtur_0261
  Energy metabolism
   00680 Methane metabolism
    Dtur_0261
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Dtur_0261
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Dtur_0261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_6 Fer4_10 Fer4_7 Fer4_16 Fer4_9 Fer4_8 Fer4_2 Fer4_4 Fer4_15 Fer4_17 Fer4_13 Fer4_22
Motif
Other DBs
NCBI-GeneID: 7083084
NCBI-ProteinID: YP_002352201
UniProt: B8E1R2
Position
267387..267665
Genome map
AA seq 92 aa AA seqDB search
MKLPGWKELVNIGPILPAQTSKEYKTGDWRTFRPEIDYNKCTTCMFCWLFCPDSAVKFDG
QKVYIDYDYCKGCGVCAAECPVKAITMKEEEK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaccaggatggaaagaattagtaaatataggtcctattttacctgcacagact
tctaaagagtataagacgggggactggagaacctttaggcctgaaattgactataacaaa
tgtactacttgtatgttttgctggctcttctgtcctgattctgcagtaaaatttgatggt
caaaaggtttatattgactatgattactgcaaaggttgtggtgtttgcgcagcagaatgt
cctgtcaaagcaataaccatgaaagaagaagaaaaataa

DBGET integrated database retrieval system