KEGG   Dictyoglomus turgidum: Dtur_0334Help
Entry
Dtur_0334         CDS       T00800                                 

Definition
(RefSeq) iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
dtu  Dictyoglomus turgidum
Pathway
dtu00010  Glycolysis / Gluconeogenesis
dtu00350  Tyrosine metabolism
dtu00625  Chloroalkane and chloroalkene degradation
dtu00626  Naphthalene degradation
dtu01100  Metabolic pathways
dtu01110  Biosynthesis of secondary metabolites
dtu01120  Microbial metabolism in diverse environments
dtu01130  Biosynthesis of antibiotics
dtu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:dtu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dtur_0334
  Lipid metabolism
   00071 Fatty acid degradation
    Dtur_0334
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dtur_0334
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Dtur_0334
   00626 Naphthalene degradation
    Dtur_0334
Enzymes [BR:dtu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Dtur_0334
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-GeneID: 7083157
NCBI-ProteinID: YP_002352262
UniProt: B8DZ22
Position
341167..342357
Genome map
AA seq 396 aa AA seqDB search
MKENLNFPYFMPTKIWFGPGSLEKLREEKLPGKKALIVISAGGSMKKLGYLDRLIDILKS
RRVEYVVFDKILPNPIKKHVMEGAQIAREEECDFVIGLGGGSSIDSAKSIALMVKNDGDY
WDYIVGGTGKGKKPEKGALPIVAITTTAGTGTEADPWTVITNEETNEKIGYGNEYTFPTL
SIVDPELMLSVPPHLTAYQGFDAFFHAVEGYIANIANPVSDLYALKSVELIAKYLPICVK
NGNDLIARTYVALANTLSGFVESTSSCTSEHSMEHALSAFHPELPHGAGLIMLSEAYHTF
FASKIPDRYIQLAKVMGLDVDSLPEEEKPYAFIKALKKLQEECGVANLRMSDYGIKEDEI
EKLAQNAIETMGGLFEMDRYKLSFDEVVEILRKAYK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatttgaattttccatattttatgccaactaaaatatggtttggacctgga
agcttagaaaagttaagggaagagaaacttcctggaaaaaaagcacttatagttatctct
gctggaggttcaatgaaaaaacttggttatcttgataggcttatagatatcttaaaaagt
agaagggttgaatatgttgtttttgacaaaattcttcctaatcctattaagaagcatgta
atggagggagcccagattgcaagagaagaagagtgtgactttgttattgggcttggtgga
ggaagcagtattgattcagcaaaaagtatcgcattaatggtaaaaaatgatggagattat
tgggattatattgtaggaggcacaggaaaaggtaaaaaacctgagaaaggtgcgctacca
attgtagctataactaccacagcagggacaggaacggaagcagatccttggactgtaata
accaatgaggaaactaatgaaaagattggatatggaaatgagtatacttttcccacttta
tccattgtagatccagaacttatgttaagtgttcctcctcatcttactgcctatcaagga
tttgatgcctttttccatgcagtagagggatatattgcaaatattgctaatcctgtaagt
gatctttatgctttaaaaagtgtagagttaattgctaaatatttgccaatttgtgttaaa
aatggtaatgatcttattgcgagaacttatgtggctcttgccaatactctttcaggattt
gttgagagtacatcaagctgtacttcggaacattccatggagcatgctctttctgctttt
catccagaacttccccatggagctggtttgattatgctttctgaggcttaccatacattt
tttgcttctaagattcctgatagatatattcaacttgctaaagtaatgggattagacgta
gattctctccctgaagaagaaaaaccttatgcttttattaaagcattgaagaagctacaa
gaagagtgtggagtagcaaatttaaggatgtctgattatggtataaaagaagatgagatt
gaaaaattagctcaaaatgctatagagactatgggaggactttttgaaatggatagatat
aaactaagttttgatgaggtagtggaaatattgagaaaagcatataagtaa

DBGET integrated database retrieval system